Property Summary

NCBI Gene PubMed Count 525
PubMed Score 10795.33
PubTator Score 473.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease -1.600 1.2e-02
Barrett's esophagus 1.400 3.1e-02
psoriasis -2.300 2.0e-04
group 3 medulloblastoma -2.600 4.3e-05
medulloblastoma, large-cell -2.800 7.9e-06
primitive neuroectodermal tumor -1.400 2.3e-02
Atopic dermatitis -1.600 1.2e-04
tuberculosis -3.200 1.1e-04
primary pancreatic ductal adenocarcinoma 1.185 2.9e-02
intraductal papillary-mucinous adenoma (... 1.200 2.3e-02
lung cancer -3.600 3.7e-07
atypical teratoid/rhabdoid tumor -1.100 3.5e-02
nasopharyngeal carcinoma -2.800 2.0e-06
lung adenocarcinoma -1.047 2.8e-02
lung carcinoma -2.900 2.8e-33
breast carcinoma -1.300 8.5e-23
spina bifida -2.147 4.1e-02
Breast cancer -2.300 1.4e-10
invasive ductal carcinoma -1.800 1.3e-03
ulcerative colitis 2.800 6.7e-08
ovarian cancer -1.400 2.3e-03
pituitary cancer -2.100 4.4e-04
chronic rhinosinusitis -1.018 4.8e-02
pancreatic cancer 1.400 6.2e-03

Protein-protein Interaction (4)

Gene RIF (483)

PMID Text
27057091 The findings of the study show an increased expression of tissue factor in the lesional and perilesional skin of patients with bullous pemphigoid. The expression of TF was not observed in biopsies from healthy people and dermatitis herpetiformis patients.
26797521 We conclude that API M358R inhibits FVIIa by forming inhibitory complexes of the serpin type more rapidly than AT in the absence of heparin.
26791271 This study suggests that ROCK/YAP/Egr-1 signaling regulates tissue factor expression after stimulation with lipopolysaccharide in endothelial cells.
26731648 Data indicate that IGF-binding protein 3 (IGFBP3) and F3 gene expression levels in formalin fixed paraffin embedded (FFPE) prostate cancer tissue would provide an improved survival prediction for prostate cancer patients.
26694616 Data suggest that allosteric regulation of FVIIa activity by tissue factor/thromboplastin binding appear to involve direct interaction with FVIIa active site, stabilizing segment 215-217, activating loop 3, and leading to enhanced FVIIa activity.
26631725 Activation of P2Y2R increased TF promoter activity and mRNA expression in coronary artery endothelial cells.
26504080 B-Raf(V600E) mutation in metastatic melanoma cells up-regulated tissue factor expression on cell membranes and promoted thrombin production
26471500 expression by myeloid cells affects macrophage differentiation, and regulate Mycobacterium tuberculosis growth
26408927 TF plays more fundamental roles in cancer biology. TF regulates tumor cell dormancy, is associated with cancer stem cell behavior, epithelial-to-mesenchymal transition, and dictates establishment of the tumor cell premetastatic niche.
26408926 Clinical Significance of Tissue Factor-Exposing Microparticles in Arterial and Venous Thrombosis.
26408925 Tissue Factor Expressed by Neutrophils
26408924 Structure-Function Relationship of the Interaction between Tissue Factor and Factor VIIa.
26408922 Cancer Tissue Procoagulant Mechanisms and the Hypercoagulable State of Patients with Cancer.
26408920 the biology of TF has become more complex by the demonstration that, apart from its known effects on blood coagulation, it is involved in intracellular signaling, proliferation, angiogenesis, and tumor metastasis.
26408918 The Role of Tissue Factor in Atherothrombosis and Coronary Artery Disease: Insights into Platelet Tissue Factor.
26408917 Soluble Tissue Factor" in the 21st Century: Definitions, Biochemistry, and Pathophysiological Role in Thrombus Formation.
26281862 Regional upregulation of the TF in the capillary endothelial cells suggests local myocardial thrombogenicity in heart failure patients.
26271343 These results indicate that TF/FVIIa signalling has a negative effect on beta cell function and promotes beta cell death in response to cytokines.
26241501 Lipopolysaccharide and E. coli activated the coagulation system by a complement- and CD14-dependent up-regulation of tissue factor, leading subsequently to prothrombin activation.
26221761 Tissue factor uptake by platelets involves the scavenger receptor CD36, SERT and engages PI3-Kinase activation and cytoskeletal assembly.
26179105 asTF expression was associated with grade and stage in ER-positive breast tumors only. Tissue factor isoform and estrogen signaling share downstream targets in BrCa; concomitant asTF and estrogen signaling is required for BrCa cell proliferation.
26169722 results suggest that these TF residues interact with the GLA domain of FX in a Mg(2+)-dependent manner (although effects of Mg(2+) on the FVIIa GLA domain cannot be ruled out).
26136249 Contribution of FXIa and platelet-derived polyphosphate in thrombin generation varies depending on surface tissue-factor level.
26065856 PGE2 increases both TF expression and activity through the regulation of the EP1/SIRT1 pathway.
26062685 Tissue factor is an endogenously synthesised protein that characterises megakaryocyte maturation and that it is transferred to a subset of newly-released platelets where it is functionally active and able to trigger thrombin generation.
26025445 tissue factor is a valuable diagnostic biomarker for the diagnosis of sepsis-induced acute respiratory distress syndrome.
26018600 Data suggest that tissue factor (thromboplastin) functions in initiation phase of blood clotting cascade and contributes to regulation of hemostasis versus thrombosis. [REVIEW]
25963480 High serum Tissue Factor levels are associated with Pancreatic Cancer.
25931463 data provide evidence that elevated levels of circulating TF are potential risk factors for ischemic strokes.
25923092 Tissue factor (TF) and fibrinogen in peripheral artery disease patients undergoing endovascular revascularization can participate in the formation of restenosis.
25903973 The most cell proliferation and cyclin D1 expression were seen in cells expressing wild-type or Asp253-substituted TF. Increased cellular apoptosis was seen in cells expressing Ala253-substituted TF or pre-incubated with TF-rich microvesicles.
25881103 Inhibition of NMMHC IIA impedes TF expression and venous thrombosis via Akt/GSK3beta-NF-kappaB signalling pathways in the endothelium both in vitro and in vivo.
25864889 TNFalpha and Stx-1 compared to TNFalpha alone leads to an increase in procoagulant TF on endothelial cells, which is explained by a significant decrease in TFPI not co-localized with TF and not to an increase in TF not co-localized with TFPI
25823853 Pregnancy was not associated with changes in cell origin of circulating maternal microparticles or in the number of tissue factor-expressing microparticles.
25683933 Results indicate that plasma TF level was positively correlated to the level of MCP-1. Monitoring of plasma TF and MCP-1 levels in AECOPD patients could be a way to prevent hypercoagulability, cardiovascular and cerebrovascular thrombotic diseases.
25665657 Association between micro particle-tissue factor activity, factor VIII activity and recurrent VTE in patients with acute pulmonary embolism.
25653143 Hyperglycemia of short duration increases TLR4 and TF-procoagulant activity, key players in inflammation and thrombosis.
25631539 Tissue factor-regulated vascular smooth cell migration and microvessel formation is under the control of the ER-protein PDIA2.
25596265 Heme promotes tissue factor-dependent coagulation activation and induces tissue factor expression on leukocytes in vivo.
25490770 RAGE/MT1-MMP axis modified HMBG-1-mediated TF expression through RhoA and Rac1 activation and NF-kappaB phosphorylation in endothelial cells
25465717 Neutrophil elastase mainly enhances tissue factor production by monocytes via the phospholipase C/conventional PKC/p38 MAPK pathway, although a novel PKC is also involved.
25463083 MiR-223-mediated suppression of TF expression provides a novel molecular mechanism for the regulation of coagulation cascade
25450387 TF expression correlates with poor prognosis in glioma, but not in Glioblastoma multiforme.
25427791 Plasma levels of tissue factor (and IL-18) are significantly increased in patients with acute coronary syndrome.
25425620 Tissue factor-rich endothelial microparticles released by microvascular endothelial cells can overcome the consequences of arterial occlusion and tissue ischemia by promoting postischemic neovascularization and tissue reperfusion.
25407675 Common genetic variation in tissue factor was significantly associated with outcome of severe sepsis in Chinese Han population.
25403348 Molecular dynamics simulation of tissue factor activation of factor VIIa.
25312727 Tissue factor (TF) is known to be the key element in the initiation of the extrinsic pathway of the coagulation cascade and appears to be a critical determinant of atherosclerotic plaque thrombogenicity.
25281742 Data indicate that the Eph tyrosine kinase receptors EphB2 and EphA2 are involved in factor/coagulation factor VIIa (TF/FVIIa) signaling.
25262106 Microparticle-associated tissue factor activity did not differ between patients with acute deep vein thrombosis and healthy controls.
25242242 Alpha-1 proteinase inhibitor M358R inhibits endogenous thrombin on cells co-expressing tissue factor.
25171777 Blockade of endothelial Cx32 increased tissue factor expression induced by TNF-alpha stimulation and cell-cell interaction via ICAM1. Direct Cx32-mediated interaction modulates TF expression in ECs during vascular inflammation.
25163770 Describe inhibition of tissue factor:factor VIIa-catalyzed factor IX and factor X activation by TFPI and TFPI constructs.
25116956 Alternatively spliced tissue factor promotes plaque angiogenesis through the activation of hypoxia-inducible factor-1alpha and vascular endothelial growth factor signaling.
25038529 results extend the involvement of heterochromatic gene silencing in senescence beyond cell cycle-related genes and suggest a novel anti-cancer mechanism of senescence through inhibition of tissue factor inducibility
24998411 Overexpression of miR-19b inhibited TF expression and procoagulant activity.
24966616 Colon tissue factor levels are increased in ulcerative colitis.
24920554 Results suggest that overexpression of CD133, CD44v6 and TF is associated with pancreatic carcinoma metastasis.
24759146 This covers the expression and regulation of TFA by hepatocytes, the role of TFA in coagulation triggered by liver toxicity, and the contribution of coagulation activity to the progression of liver disease. [review]
24755284 TF expression levels in pretreatment biopsy samples are useful for predicting response to neoadjuvant chemotherapy in advanced esophageal cancer.
24568471 High tissue factor expression is associated with breast cancer.
24516673 These studies reveal the functional contributions of residues in the C-terminal half of the tissue factor ectodomain that are implicated in interacting with phosphatidylserine headgroups.
24470301 Patients with cirrhosis have increased levels of circulating microparticle tissue factor activity.
24448154 Neither genetic polymorphisms nor the plasma levels of TF seem to act as direct risk factors for venous thromboembolism.
24385191 Tissue factor inflammatory response regulated by promoter genotype and p38 MAPK in neonatal versus adult microvascular endothelial cells.
24378263 Cirrhotic patients with type 2 diabetes have increased expression of monocytic CD142 in comparison with cirrhotic non-diabetic, diabetic and healthy controls. This increases significantly with increase of the stage of the Child-Pugh score.
24342062 Suggest that cell confluence and the type of flow are critical independent factors in the induction of TF and PECAM-1 phosphorylation in endothelial cells exposed to disturbed pulsatile flow and chemical stimuli.
24108579 hemoglobin upregulates and binds to tissue factor on macrophages, which may have a role in coagulation and oxidative stress
24094893 TF expression was increased in clear cell ovarian cancer and endometroid cancer and this may explain the higher risk of venous thromboembolism in these subgroups.
24021283 an interaction between p27(Kip1) and TF in important pathological alterations such as atherosclerosis and vascular remodeling
23803674 the numbers of glial-derived and/or TF-bearing microparticless were high in glioblastoma multiforme patients both before and even more after the neoplasm was treated, increasing the risk of VTE
23801760 Targeting asTF may comprise a previously unexplored therapeutic strategy in BrCa that stems tumor growth, yet does not impair normal hemostasis
23798713 Results suggest that tissue factor (TF)-positive microparticles (MPs)_ may be a useful biomarker to identify patients with cancer who are at high risk for thrombosis.
23754313 Our findings demonstrate that alternatively spliced tissue factor is expressed in pancreatic ductal adenocarcinoma (PDAC) and lymph node metastases and potentiates PDAC spread in vivo.
23666757 Data indicate that miR-19a was significantly inversely correlated with tissue factor (TF) expression in stage I ( and II, but not significant in stage III or IV.
23640483 4-Hydroxy-2-nonenal increases TF coagulant activity in monocytic cells through a novel mechanism involving p38 mitogen-activated protein kinase activation that leads to enhanced phosphatidylserine exposure at the cell surface.
23623171 It is concluded that platelets free of monocytes do not express TF activity when stimulated by Lipopolysaccharides or activated complement factors, implying no role for Toll like receptor (TLR4) as suggested recently.
23621622 Data demonstrate that TF encryption is not limited to a specific cell type, and unlike previously thought, the majority of the TF expressed in cancer cells is not constitutively procoagulant.
23604472 our results suggest that the pro-angiogenic potential of A549 lung cancer cells is modulated under hypoxic conditions via modulation of TF isoform expression which in turn is controlled by alternative splicing.
23585459 These results demonstrate that coagulation kinetics for circulating tissue factor particles are controlled by factor IX and X levels within the normal physiological range.
23578769 present in seminal fluid and is highly procoagulant
23539451 Tissue factor promoted tumor growth may be attenuated by EPCR expression.
23524311 The expression of tissue factor and tissue factor pathway inhibitor in prostate cancer cells themselves is unlikely to be the source of hypercoagulability in patients, but might precipitate chains of events that would produce such an effect.
23490466 In rheumatoid arthritis, tissue factor is expressed not only by the synoviocytes themselves, but also the infiltrating CD19+ B cells and CD68+ macrophages, and is involved in the pannus invasion in the progression of the disease.
23434438 The reduction of TF disulfides (with or without alkylation) eliminates TF regulation of factor VIIa catalytic function in both membrane dependent FX activation and membrane independent synthetic substrate hydrolysis.
23409769 Hypoxia-induced expression of TF in human breast cancer cells depends on Egr-1 and HIF-1alpha, and both of these proteins may play an important role in breast cancer metastasis, either directly or indirectly through the TF pathway.
23383108 HIV-1 Vif upregulates the expression of coagulation factor III (F3, thromboplastin, tissue factor) in Vif-expression T cells
23373413 This review article presents the established knowledge of tissue factor expression in endothelial cells and current opinions on encrypted TF form and mechanisms of its activation.
23333304 HIV-1 Vif upregulates the expression of coagulation factor III (F3, thromboplastin, tissue factor) in Vif-expression T cells
23325480 Studies indicate that tissue factor (TF) by forming a complex with factor VIIa (FVIIa) initiates blood coagulation.
23294934 FVa, via its light chain, binds to the complex TF/FVII(a) and prevents it from activating FX.
23223577 By modifying Cys residues or regulating Cys redox states in TF extracellular domain, hTrx1/TrxR function as a safeguard against inappropriate TF activity.
23152142 Presence of TF within microparticles enhances the interactions of endothelial cell-derived microparticles with extracellular matrices in an integrin-dependent manner, enhancing TF activity.
23118232 epithelial-to-mesenchymal transition-like changes may alter cancer cell interactions with the vascular systems through altered vesiculation and TF shedding.
23065128 TF inhibition caused basal cell apoptosis and necrosis. This was due to two parallel but interdependent TF-regulated processes: failure to generate a basal cell-associated fibrin network and suboptimal PAR1 and PAR2 activity.
23038262 PAK1 negatively regulates the expression of TFPI and additionally contributes to increased TF activity.
23029190 data show that Mtb induces TF expression in macrophages and Mtb signaling pathways that elicit TF induction require cooperation of multiple receptors, co-receptors/co-factors including Toll-like receptors
23029002 Study demonstrates the involvement of autophagic machinery in the extracellular delivery of TF in Neutrophil extracellular traps and the subsequent activation of coagulation cascades.
23007470 study demonstrated for that TF regulates tumor angiogenesis of retinoblastoma; found that TF is expressed by endothelial cells of retinoblastoma, whose expression is upregulated with the proliferation of endothelial cells
22964479 anti-beta(2)GPI/beta(2)GPI complex induced TF and TNF-alpha expression involving both TLR4/MyD88 and TLR4/TRIF signaling pathways and TLR4 and its adaptors might be molecular targets for therapy of antiphospholipid syndrome
22828416 increased expression in bronchial asthma
22784289 In endothelial cells, TF forms a complex with Akt activating Raf/ERK and Ets-1 signaling induces microvessel formation
22771387 Transforming growth factor-beta1 markedly enhanced tissue factor expression in primary human lung fibroblasts.
22705067 Increased numbers of circulating tisse factor exposing microparticles were found in patients with IBD, but lack of association with coagulation system activation and disease activity questions their role in venous thromboembolism in this group.
22683021 Our data demonstrate that ixolaris targets B16F10 cell-derived TF, resulting in the reduction of both the primary tumor growth and the metastatic potential of melanoma, as well as the inhibition of tumor angiogenesis.
22682138 In this review, we aim to present a side-by-side evaluation of normally-spliced, full length TF (flTF) and asTF with regard to coagulant function, atherosclerosis, tumor progression and malignancy-associated thrombosis.
22682123 Here we review the evidence that TF-dependent signaling is the major driver of primary tumor growth.
22672593 The abnormal co-upregulated expression of TF and PAR-2 in eutopic and ectopic endometrium may affect the development and growth of endometriotic lesions.
22547577 Only TF-positive cell lines activated coagulation in nude mice, and this activation was abolished by an anti-human TF Ab.
22461171 Preeclampsia: the role of tissue factor and tissue factor pathway inhibitor.
22437887 Caffeine enhances TNF-alpha-induced endothelial TF protein expression as well as surface activity by inhibition of PI3K signalling.
22340074 Letter/Meta-Analysis: F3 rs12029080 variant was not associated with risk of incident venous thrombosis.
22237453 Data show that Tissue factor (TF) down-regulation diminished matrix metalloproteinases MMP-2 and MMP-9 expression and promoted reversion to suspension growth.
22214850 Results suggest that the prothrombotic state associated with hypercholesterolemia is caused by oxLDL-mediated induction of tissue factor expression in monocytes via engagement of a TLR4/TLR6 complex.
22212466 Bivalirudin reduces periprocedural platelet activation and inhibits thrombin-induced tissue factor expression in vascular smooth muscle cells.
22196362 High expression of monocyte TF was strongly associated with the prevalence of arteriosclerosis obliterans and the presence of anti-phospholipid antibodies.
22187432 the dynamics of zymogen activation when both extrinsic tenase and prothrombinase are assembled on an appropriate membrane
22178066 Our findings indicate that circulating monocytes of asymptomatic individuals with echolucent lipid-rich carotid atherosclerosis express an imbalance between TF and TFPI.
22156911 Platelet and microparticle expression of tissue factor was not related to plasma levels of HIV but expression of P-selectin was related to plasma levels of HIV; neither tissue factor nor P-selectin expression was related to CD4 T-cell count.
22119392 BMP-2 can inhibit LPS-induced TF protein expression and surface presentation in human MNCs by downregulation of Erk1/2, p38, and JNK signaling.
22115773 When monocytes are stimulated with cytokines or chemokines, tissue factor is expressed by the cytokines granulocyte-macrophage colony stimulating factor (GM-CSF), interferon (IFN)-gamma and tumor necrosis factor (TNF)-alpha.
22099707 Total circulating tissue factor positive microparticles are elevated in recurrent deep venous thrombosis patients versus normal individuals (P=0.001).
22076613 A novel TF/FVIIa/MAPK/c-Fos/MMP-7 axis plays an important role in modulating the invasion of colon cancer cells.
22066736 Evolutionary conservation of the tissue factor disulfide bonds and identification of a possible oxidoreductase binding motif.
22022598 TF activity is expressed by syncytiotrophoblast microvesicles.
21934552 Data indicate that integrin beta6, CD46, tissue factor, and chromosome 14 open reading frame 1 (C14ORF1), were identified as overexpressed on pancreatic cancer cell lines.
21868706 Endogenous TF regulates CCL2 production in endothelial cells. Secreted CCL2 mediates the angiogenic effect of TF by recruiting smooth muscle cells toward endothelial cells and facilitates the maturation of newly formed microvessels.
21800004 decreased in patients with chronic heart failure following treatment with omega-3 polyunsaturated fatty acids
21762960 We propose that the increase in cellular TF activity in circulating leukemic cells, combined with increased numbers of TF-positive MPs, may contribute to thrombosis in cancer patients receiving chemotherapy
21737126 Measurement of microparticle TF activity in plasma may be used to detect a prothrombotic state in patients with various diseases.
21694469 Data show that D-dimer and factor VIII may be used as yardstick for systemic adjuvant therapy in node negative < 1 cm breast cancer.
21693061 TF is highly expressed in squamous and adenocarcinoma of the uterine cervix and its cell lines.
21690060 Microgravity can inhibit the proliferation of THP-1 cells and suppress the cellular expression of TF mRNA.
21652710 P2Y(2) receptor mediates TF expression in HCAEC through new mechanisms involving Src/p38 and Rho/JNK pathways, possibly contributing to a pro-thrombotic status after vascular injury.
21625939 the data in this study suggest that the interaction between FVIIa and TF induces PAR2 activation, thereby triggers the ERK1/2 and IkappaB-alpha/NF-kappaB signal transduction pathway to regulate the gene expression of IL-8, TF, and caspase-7
21621407 The TF - factor VIIa complex in human pancreatic cancer cells produced a significant amount of MMP-9 and promoted invasion ability in vitro and invasion and metastasis in vivo.
21619686 Down-regulation of TF using siRNA could provide a potential approach for gene therapy against lung adenocarcinoma.
21617868 tissue factor expression in retinoblastoma cells is closely related to tumor cell proliferation
21605334 Statins prevent tissue factor induction by PAR-agonist peptides altering the membrane localization of PAR1 and the expression of PAR2.
21592524 While uniform laminar flow resulted in transient TF expression, disturbed flow induced sustained amplification of TF expression.
21543928 The interaction between the TF-FVIIa complex might play a role in mediating epithelial ovarian cancer invasion and metastasis depending on monocytes mechanism.
21535396 Glycosylation is not essential for TF transport and coagulant or signaling functions.
21531894 Data indicate that colonic myofibroblasts expressed TF in an endothelin-1-dependent manner.
21518473 Alternatively spliced tissue factor has no role in the coagulation disorder of AML.
21502573 Three genes were associated with fibrin D-dimer levels; Of these 3, the F3 association was the strongest
21500176 Circulating tissue factor and microparticles are not elevated in deep venous thrombosis.
21488215 Tissue factor may enhance hematogenous metastasis through extravascular migration of fibrosarcoma cells.
21483174 Upregulation of monocyte tissue factor activity is significantly associated with carotid intima-media thickness in patients with metabolic syndrome.
21474669 an unexpected procoagulant role of the protein C pathway that may have important implications for the regulation of TF- and TFPI-dependent biologic responses and for fine tuning of the hemostatic balance in the vascular system.
21467727 Low concentrations of oxLDL enhance TF expression in MDMs, whereas higher concentrations attenuate TF expression both at baseline as well as following LPS stimulation
21464728 Tissue factor expression was significantly more likely to be seen in pure clear cell component than in all other cancers as a group
21458031 Study demonstrates that all trans-retinoic acid downregulates the expression of tissue factor and cancer procoagulant in breast cancer cells.
21404058 TF may participate in both K-ras and p53 mutations involved in colorectal carcinogenesis.
21367569 Laminar shear stress and thrombin independently increased endothelial cell tissue factor expression, but orbital shear stress did not.
21344386 The increase in TF protein levels by progesterone is not coupled to the progesterone increase in TF-mediated coagulation. In epithelial derived cancer cells, TFPI can inhibit coagulation without causing the relocalization of TF.
21310953 Study propose a sequential mechanism in which the phosphorylation of Ser253 through PAR2 activation results in the incorporation of TF into microparticles, simultaneously inducing Ser258 phosphorylation.
21293108 Plasma tissue factor levels and salivary tissue factor activities of periodontitis patients with and without cardiovascular disease.
21248061 TF may also be associated with cell-derived vesicles to facilitate coagulation when saliva directly contacts blood.
21245964 TF plays a potential role in the pathogenesis and development of a pterygium
21236471 Active FXI and tissue factor are present in stable chronic obstructive pulmonary disease patients, who exhibit enhanced systemic inflammation and thrombin generation.
21186047 Gene expression analysis of HUVEC showed 148 up-regulated and 29 down-regulated genes 4h after TF binding.
21182229 Tissue factor (TF) levels are raised early in severe acute pancreatitis, and TF as an early predictive marker of severe AP is superior to CRP, but inferior to IL-6.
21160057 Demonstrate a novel regulation and role for cortactin in FVIIa/TF-mediated endothelial cell migration that occurs through a PAR2 and RhoA dependent mechanism.
21149441 EPCR interacts with the ternary TF coagulation initiation complex to enable PAR1,2 signaling.
21129276 Endothelial cell lesions and abnormal expression of TF play a crucial role in graft-versus-host disease.
21091668 These results indicate that TLR-4 and its signal transduction pathway contribute to anti-betaGPI/betaGPI-induced TF expression in THP-1 cells, and the effects of TLR-4 with ANX2 are tightly co-operative.
21059650 miR-19 regulates tissue factor expression in breast cancer cells, providing a molecular basis for the selective expression of the tissue factor gene
21042291 Upregulated tissue factor(TF) expression may be associated with age-related macular degeneration(AMD), and inflammatory and oxidative stress may contribute to TF expression in AMD eyes.
21037076 TF-PAR-1 pathway contributes to liver fibrosis induced by chronic cholestasis by increasing expression of the alphaVbeta6 integrin, an important regulator of transforming growth factor-beta1 activation.
20978007 Sirt1 inhibition enhances tissue factor expression and activity by increasing NFkappaB/p65 activation in endothelial cells.
20933205 role in cardiovascular disease (Review)
20930172 Low concentrations of alpha-thrombin accelerate tissue factor-induced thrombin generation on the surface of vascular smooth muscle cells, and this effect is mediated by PAR-3 and PAR-4.
20846886 Tissue factor expression on monocytes is markedly increased in patients with severe dengue fever in the acute phase of the disease when compared with patients with mild disease and healthy individuals
20830515 TF has a direct effect on primary breast cancer growth and angiogenesis.
20810696 the TWEAK-Fn14 axis can regulate activation of TF and PAI-1 expression in vascular cells
20708733 there is a proinflammatory role of FVIIa in human SMC dependent on expression of TF and PAR-2 that provides yet another link between coagulation and inflammation
20708219 In patients presenting with symptoms of pulmonary embolism there is no association between microparticle-associated tissue factor activity levels and a confirmed acute pulmonary embolism.
20688968 In contrast to other studies, assays with highly sensitive MAbs show that platelets do not express detectable TF antigen or activity.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20656331 In vitro treatment of whole blood with BMP7 markedly increased the population of tissue factor-positive monocytes from 1.5+/-0.6 % to 31.0+/-7.6 % (p<0.001).
20628259 resistin may contribute to atherothrombosis, exerting direct effects on vascular endothelium by promoting TF expression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616308 Recombinant or microparticle-associated tissue factor stimulate endothelial cell proliferation through activation of the ERK 1/2 pathway, mediated through a novel mechanism requiring the interaction of exogenous TF with cell surface beta1-integrin.
20605795 blocking GRP78 signaling on the surface of cancer cells attenuates TF PCA and has the potential to reduce the risk of cancer-related venous thromboembolism.
20601186 These results indicate that the ASK1-p38 MAPK cascade may regulate LPS-induced TF expression in pulmonary microvasculature.
20589316 Inhibition of thrombin generation by blocking upstream proteases (FVIIa and FXa) in the blood coagulation cascade is as effective as direct thrombin inhibition in preventing tissue factor-induced platelet aggregation.
20553947 Modulation of the oncogene-dependent F3 expression by kinase suppressor of ras 1 is reported.
20546120 Proinflammatory conditions up-regulate TF expression in endothelial colony-forming cells
20524980 analysis of coagulation factor VII and its complex formation with tissue factor in dog and human
20452482 Observational study of gene-disease association. (HuGE Navigator)
20451919 Factor Xa induces tissue factor expression in endothelial cells by P44/42 MAPK and NF-kappaB-dependent pathways.
20434015 This review details the evidence for tissue factor bearing microparticles in the malignant state and its association with thromboembolic phenomena.
20434004 Tissue factor overexpression accompanies features of cellular aggressiveness such as markers of CSCs (CD133), epithelial-to-mesenchymal transition and expression of the angiogenic and prometastatic phenotype.
20434002 Tissue factor signaling involving protease activated receptor PAR2 and integrins has multiple effects on angiogenesis and tumor progression.
20388709 Data demonstrated that the P2' side chain was indeed crucial for PAR2 cleavage by TF.FVIIa.
20338779 Studies indicate that calculation of INR is based on the availability of International Standards (IS) for thromboplastin and a calibration model.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237315 TF lacking the Cys186-Cys209 bond is coagulantly active once it is complexed with FVIIa, and TF de-encryption does not require Cys186-Cys209 disulfide bond formation
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20224254 relationship between oxidant stress, lipids and thrombosis and consequently may contribute to understanding the mechanism through which Ox-LDL and TF may mediate the pathogenesis of coronary artery disease
20189224 review of tissue factor-positive microparticles in clinical disease states [review]
20185792 Acadesine inhibits TF expression and thrombus formation by activating the phosphoinositide 3-kinase/Akt pathway.
20171716 review of tissue factor microparticles and haemophilia [review]
20163832 PDI has a role in regulating tissue factor that involves FVIIa activity [review]
20156644 review of the structure of the factor VIIa (FVIIa)/tissue factor (TF) and factor Xa (FXa) ternary complex [review]
20153879 review of current status of tissue factor activation of factor VIIa [review]
20150920 The association between the functional polymorphism (-603A --> G) in the TF gene promoter and adult-onset asthma indicates that TF is a candidate gene contributing to asthma susceptibility.
20149924 analysis of tissue factor activity under flow [review]
20149415 review of tissue factor expression in blood cells [review]
20142117 Simvastatin and ezetimibe did not alter tissue factor levels in patients with hypercholesterolemia.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20138335 review of posttranslational modifications and activity of natural and recombinant tissue factor [review]
20133705 PML/RARalpha transactivates the TF promoter through an indirect interaction with an element composed of a GAGC motif and the flanking nucleotides, independent of AP-1 binding.
20113254 no association between the TF +5466A>G or -1208D>I variants and clinical or laboratory markers of disease activity and/or severity in patients with rheumatoid arthritis.
20103969 Upregulation of monocyte TF is significantly associated with low-grade inflammation and insulin resistance in metabolic syndrome X
20062929 Blocking TF-FVIIa-dependent activation of factor X and factor IX may be an attractive approach for preventing thrombosis.
20061396 Data suggest a role for novel phospholipid-esterified eicosanoids in promoting blood coagulation via tissue factor-dependent thrombin generation.
20034913 Significant differences were found in the levels of plasma TF between the multiple trauma patients (on the first, second, third posttrauma days) and the control group.
19995406 Letter: Study suggests that mRNA specific for alternatively spliced TF could be measured in lung tumors together with transcripts specific for full-length TF to evaluate prognosis in patients with non-small cell lung cancer.
19966052 High molecular weight kininogen (HKa) mimics lipopolysaccharides by triggering a paracrine pathway in monocytes that depends on TNF-alpha and IL-1beta. Upregulation of tissue factor in monocytes by cleaved HKa is dependent on TNF-alpha and IL-1beta.
19958818 Our results suggest an important role for the TF/FVIIa/PAR-2/ERK axis in tumor growth and invasion of glioma and suggest that TF may be a suitable target for the development of novel therapies against high-grade glioma.
19954621 p38 MAPK JNK inhibitors SB203580 and SP600125 reduced allogeneic T lymphocytes-induced TF expression in HUVECs.
19923558 FVII/FVIIa is bound to essentially all the TF molecules on cells in blood and the surrounding vessel wall. Review.
19914247 The results reveal an opposing and uncoupling effect of mTOR and S6K1 in regulating TF expression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19904262 cancer cell-derived TF-fVIIa could cause thrombotic events in ovarian cancer patients.
19880163 Myocardial infarction-patients had elevated postprandial lipemia and retained their ability for tissue factor-induced thrombin generation in plasma ex vivo in the postprandial phase, whereas the capacity gradually decreased in healthy individuals.
19861441 tumor-derived tissue factor-bearing microparticles are associated with venous thromboembolic events in cancer patients and may be central to the pathogenesis of cancer-associated thrombosis
19856410 Tissue factor -1208D>I polymorphism is associated with high D-dimer levels in patients with inflammatory bowel disease.
19843576 The intron preceding TF exon 5 possesses characteristics rarely found in U2 introns. Modulation of TF pre-mRNA splicing can be accomplished via modification of SR proteins' activity.
19829668 Tissue factor expression may play a role in the process of developing hepatic metastasis.
19828697 Increased tissue factor expression on circulating monocytes in chronic HIV infection: relationship to in vivo coagulation and immune activation.
19817993 inhibition of both A- and N1-Smase might explain the upregulatory effect of agLDL on TF activation, and suggest that this effect is related, at least in part, to membrane SM enrichment.
19806259 activity is increased after total knee arthroplasty
19795460 First evidence to link PAR-2 expression and TF phosphorylation to clinical data in human breast cancer. In conjunction with experimental tumor models, these data support an important role of TF-PAR-2 signaling in breast cancer recurrence.
19750223 By triggering TF release in the circulation, Stx and LPS can induce a prothrombotic state contributing to the pathogenesis of hemolytic uremic syndrome
19698254 The tissue factor promotor polymorphism -1208I/D is not associated with venous thromboembolism.
19661141 Combined oncogene events affecting tumor suppressor genes dramatically increase TF gene expression in lung tumors. Moreover, this study suggests that TF gene expression could be used as a prognostic marker in NSCLC.
19631649 Results suggest that CRP may promote coagulation by enhancing the expression and activity of TF and reducing that of TFPI by activating NF-kappaB and extracellular signal-regulated kinases 1 and 2 via FcgammaR II.
19628788 Propose that both tumor cell-associated and host-related TF could influence the properties of cancer stem cells. Review.
19604541 flavonoids have an effect on tissue factor expression in human monocytes
19597299 The PI3K/Akt pathway modulates alternative splicing of TF in endothelial cells.
19592470 TF structure-function relationships and the role of TF during various phases of the blood coagulation process. Review.
19583819 TF genetic variations are associated with the risk of ischemic stroke at young age
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19572083 +5466A>G polymorphism of TF may be a risk factor for cryptogenic ischemic stroke
19561489 Combinations of collagen and TF always enhance thrombogenesis, but small amounts of TF on collagen surfaces resulted in the most procoagulant combination.
19558505 TF expression on monocytes in AMI patients was significantly elevated, yet the numbers of circulating microparticles bearing TF on their membrane were significantly decreased in peripheral blood, caused by adhesion to the coronary thrombus
19545871 Letter: Discuss potential contribution of tissue factor variability to the interracial differences in the incidence of cardiovascular disease.
19541671 Serotonin enhances platelet procoagulant properties and their activation induced during platelet tissue factor uptake.
19515372 Tissue factor gene promoter haplotype associates with carotid intima-media thickness in subjects in cardiovascular risk prevention.
19500510 Data show there are significant positive correlation between TF or PAI-1 secretion of HUVEC and corresponding serum TNFalpha level in the group without heparin.
19492160 tissue factor-specific procoagulant activity of plasma microparticles is increased in patients with early-stage prostate cancer
19483295 TF is positively correlated with AngII in chronic heart failure patients.
19428056 TF immunopositivity in esophageal squamous cell carcinomas tissues is strongly correlated to the intratumoral angiogenesis and to poor patient prognosis
19424642 Evidence for increased expression of tissue factor and protease-activated receptor-1 in human esophageal cancer.
19359592 HGF-induced activation of the Met receptor results in TF expression by MB cells and that this event probably contribute to tumor proliferation by enabling the formation of a provisional fibrin matrix.
19356953 Expression of t-PA, PAI-1, TF, TFPI, TM, CD68 and VE-cadherin were significantly increased in the early symptomatic group, but the level of gene expression in the late symptomatic group was indistinguishable from the asymptomatic group.
19350119 Microparticle-linked tissue factor activity and increased thrombin activity play a potential role in fibrinolysis failure in ST-segment elevation myocardial infarction.
19290852 higher in placental tissue of preeclamptic pregnancies and in the peripheral blood of patients with preeclampsia
19276228 Medroxyprogesterone and thrombin significantly enhanced TF expression in term decidual cells monolayers.
19249541 Expression of TF protein in pancreatic tissues examined using Western blotting assay. Messenger RNA (mRNA) expression of TF in pancreatic tissue and isolated islets is seen after brain death.
19234141 TF is an important mediator in fetal death and growth restriction
19219655 Tissue factor and VEGF expression in prostate carcinoma: a tissue microarray study.
19203804 A young patient with two cryptogenic cerebrovascular ischemic events has a very rare minor homozygous GG genotype of tissue factor +5466A>G polymorphism.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
19167713 elevated plasma level of ADMA induces TF expression in monocytes via NF-kappaB-dependent pathway, which contributes to procoagulant phenotype of circulating monocytes in acute coronary syndromes
19167313 study shows binding uninhibited Factor VIIa affects segmental motions in sTF; decrease in Pro(79)-Pro(92)loop motions indicates loop entropy has a role in the thermodynamics of protein-protein interactions involved in allosteric control of VIIa activation
19149969 Data suggest that melagatran decreases tissue factor expression in platelet/monocyte heterotypic complexes.
19132232 Modulation of endothelial cell tissue factor and tissue factor pathway inhibitor-1 by neutrophil proteases.
19105796 This review presents the most recent data on the crosstalk between tissue factor-mediated coagulation and inflammation, with a specific emphasis on these processes in the lung.
19099647 TF expressions of monocytes and platelets in peripheral blood cells from patients with cerebral infarction were significantly higher than in normal controls.
19095643 regulation of TF by NF-kappaB transcription factor p50 is essential for the pathogenesis of deep vein thrombosis
19091315 Increased levels of procoagulant tissue factor-bearing microparticles within the occluded coronary artery of patients with ST-segment elevation myocardial infarction: role of endothelial damage and leukocyte activation.
19065458 Maternal plasma concentrations of tissue factor were higher in pre-eclampsia than in normal pregnancy, but lower in those who delivered a small for gestational age neonate.
19056482 Observational study of gene-disease association. (HuGE Navigator)
19027114 Tissue factor +5466A>G polymorphism determines thrombin formation following vascular injury and thrombin-lowering effects of simvastatin in patients with ischemic heart disease.
19027114 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19012190 PPROM is associated with specific changes in the hemostatic/coagulation system.
19002040 Activation of clotting with less than 5 pmol/l of TF facilitates thrombin and fibrin generation at low, but not at supraphysiological rVIIa concentrations
18989544 Report increased tissue factor-bearing leukocytes after off-pump coronary artery bypass surgery.
18983524 heme induces TF expression by directly activating endothelial cells; the time-course of heme-mediated TF antigen expression paralleled the induction of procoagulant activity
18983503 Insulin inhibits TF expression in monocytes and monocyte-derived microparticles through interference with G(i)alpha(2)-mediated cAMP suppression, which attenuates Ca(2+)-mediated TF synthesis.
18983492 Thrombin up-regulates TF activity in pleural mesothelial cells through the transcriptional activation of TF, whereas plasmin increases TF activity by inactivating the cell-associated TFPI by a limited proteolysis.
18983479 identify ROS originating in mitochondria as key mediators of the signaling pathways triggered by PAR1 and PAR2 engagement in endothelial cells; mechanisms downstream from PAR1 and PAR2 activation, different for the two receptors, also induced TF
18848323 Observational study of gene-disease association. (HuGE Navigator)
18846330 Homocysteine could significantly induce the expression of TF in vascular smooth muscle cells.
18835104 Case Report: Pulmonary tumor thrombotic microangiopathy caused by an ovarian cancer expressing tissue factor and vascular endothelial growth factor.
18802362 Eosinophils are the cellular source of TF in chronic urticaria skin lesions.
18677291 Elevated levels of TF and TFPI in patients with peripheral arterial occlusive disease can be independent risk factor for atherosclerotic complications.
18665928 no evidence for TF expression in high-purity preparations of immunologically isolated eosinophils
18665396 Certain levels of TF are required for the maintained viability and growth of endothelium and TF-expressing tumor cells.
18645927 in blood cells from patients with PV or ET, the presence of JAK2V617F mutation translates into activation of hemostasis, with increased expression of platelet-associated TF microparticles & formation of increased platelet/neutrophil aggregates.[review]
18642055 no significant difference in tissue factor expression between male and female subgroups; no correlation found between TF and age, BMI or total fat intake
18641355 recombinant activated protein C-mediated up-regulation of IL-10 reduces TF in circulating monocytes
18612547 Studies suggest that TF-FVIIa-FXa-mediated signaling modulates mTOR pathway activation, which regulates in part breast cancer cell migration.
18508060 C-reactive protein and tissue factor in acute coronary syndrome
18495150 Viral myocarditis is a hypercoagulative state which is associated with increased myocardial TF expression and activity. Upregulation of TF contributes to a systemic activation of the coagulation cascade.
18490736 results confirm that the procoagulant properties of bronchoalveolar lavage fluid (BALF) from Acute Respiratory Distress Syndrome patients are the result of TF induction & indicate that BALF neutrophils are a main source of TF in intra-alveolar fluid
18449421 Microparticle-associated vascular adhesion molecule-1 and tissue factor follow a circadian rhythm in healthy human subjects.
18363812 P-selectin-PSGL-1-induces TF and IL8 expression through Lyn phosphorylation, and part of the inhibitory effect of IL10 depends on reduced phosphorylation
18327399 Membrane-bound prothrombin fragment 1 is required to promote optimum Fva cofactor activity which in turn is translated by efficient initial cleavage of prothrombin by prothrombinase at Arg(320).
18315555 ASF/SF2 and SRp55 appear to interact with the variable TF exon 5 through exonic splicing enhancers at bases 39 and 87-117. Weakening of the above ESE modulates splicing of TF exon 5.
18310227 Levels of intra-alveolar TFPI in adult respiratory distress syndrome are not sufficient to block intra-alveolar TF procoagulant activity due to truncation and inactivation of intra-alveolar TFPI
18308368 Leptin induced functional TF and increased TF mRNA and protein expression in both neutrophils and mononuclear leukocytes
18297283 phosphorylation of TF at Ser258 and to a lesser extent Ser253, plays an essential role in the protective influence of TF on immune evasion by tumour cells
18292391 In acute coronary syndrome patients the greater expression of tissue factor in platelets and platelet-leukocyte aggregates strengthens the link between platelet activation, blood coagulation, and thrombus formation.
18284603 Urotensin-induced expression of TF and of VCAM-1/ICAM-1 was mediated through the Rho A-activation of the transcription factor, NF-kappaB
18278454 TF may have a role in chemotherapy resistance in human neuroblastoma and its progression, at lest in part, by regulating doxorubicin-induced ap
18278195 Prothombinase/factor III induced clotting time was used to monitor heparinization during cardiopulmonary bypass.
18217146 Found significant differences in frequency at which tissue factor was found in the plasma of patients with coronary artery disease and acute coronary syndromes.
18180609 Plasma Tissue Factor (TF) activity and percentage of TF-positive monocytes was signigficantly higher in hyperlipidemic diabetics and those with macrovascular complications
18091328 data support the role of TF in angiogenesis and disease progression of prostate cancer
18031796 the anti-apoptotic signaling of TF/FVIIa and TF/FVIIa/FXa is abolished by simvastatin, which induces apoptosis in human breast cancer cells in a NFkappaB-dependent manner
18029910 Na(+)/K(+)-ATPase is required for protein translation of endothelial tissue factor in culture.
18023707 alternative spliced TF expression promotes tumor growth, and is associated with increased tumor cell proliferation and angiogenesis in pancreatic cancer
18019946 4 models of coagulation including minimally altered whole blood induced to clot by tissue factor (TF)
18005233 Replacing the 1st 2 exons of mouse TF with the complete human coding sequence under the control of the mouse promoter mediated normal hemostasis. There may be a threshold TF level for prenatal development & a critical level for maintaining hemostasis.
18000605 whole blood tissue factor procoagulant activity and plasma FVIIa in ten patients with type 2 diabetes mellitus and 11 non-diabetic patients at baseline and 6, 12, 24, and 48 hours (h) after presentation for acute stroke
17991872 Tissue Factor/Activated Factor VII complex transactivates PDGFRbeta to regulate PDGF-BB-induced chemotaxis of monocytes and fibroblasts
17982314 the activation of monocytes and blood platelets is accompanied by the elevation of monocytic Tissue Factor expression in advanced liver cirrhosis
17977694 decrease in frequency domains of resting heart rate variability would be associated with elevated plasma levels of interleukin (IL)-6 and soluble tissue factor (sTF)
17947506 pinpoint monocytes as a major source of TF and provide solid experimental evidence for a direct transfer of TF protein from the monocytes to granulocytes in the blood
17939398 Expression of TF is inhibited by PTEN gene via inactivating PI3K/AKT pathway.
17938822 Factor VIIa/tissue factor-dependent gene regulation has a role in pro-coagulant activity
17922809 Cisplatin induced the release of endothelial microparticles that showed TF-independent thrombin generation and procoagulant activity.
17920661 TF antisense oligomer suppresses the synthesis of biologically active endothelial TF and antisense oligomers may represent a useful tool in the investigation of endothelial TF function/biology.
17901245 tumor cell TF-PAR2 signaling is crucial for tumor growth
17900273 A novel monocyte phenotype characterized by high TF/low CD36 presentation could be further developed for use as a marker for detection of individuals prone to developing prothrombotic conditions.
17898544 Low concentrations of tissue factor increased endothelial cell proliferation and higher concentrations reduced cell proliferation/triggered apoptosis.
17883595 Tissue factor expression contributes to tumor growth/regulating properties of CD133-positive tumor stem cells.
17883594 Postdelivery increase in tissue factor-dependent activation of coagulation is likely to be a natural mechanism to prevent excessive blood loss during and after delivery, and may also increase risk of venous thromboembolism.
17852460 is elevated in patients with cancer
17848177 PAR1 localization in the caveolin-enriched membrane microdomain, bound to caveolin-1, represents a crucial requirement for TF induction in endothelial cells.
17726162 the present data undermine the recently proposed hypothesis that PDI-mediated disulfide exchange plays a role in regulating TF procoagulant and cell signaling functions.
17724132 Metabolism of endocannabinoids by the endothelial cell COX-2 coupled to the prostacyclin (PGI(2)) synthase activates the nuclear receptor peroxisomal proliferator-activated receptor delta, which negatively regulates the expression of tissue factor.
17721619 proportion of TF-positive or both TF- and platelet antigen CD41a-positive leukocytes was increased markedly in pericardial blood obtained during CPB.
17675290 Histone deacetylase inhibitors transcriptionally inhibit agonist-induced tissue factor expression in endothelial cells and monocytes by a TF-kappaB- and HDAC3-dependent mechanism.
17663729 tissue factor and thrombin signaling have roles in cancer progression [commentary]
17598015 most abundant n-3 FA, docosahexaenoate, increases the release of TF-exposing microparticles from endothelial cells, accounting for decreased endothelial cell TF surface exposure.
17597988 review of cellular function of tissue factor: signal transduction, protein interactions
17586694 Expression of tissue factor (TF) was increased in the pulmonary arterioles and plexiform-like lesions of the rats. TF was also heavily expressed in the vessels and plexiform lesions of humans with pulmonary arterial hypertension.
17577783 Leukemia patients showing parallel activation of the studied proteins trended to exhibit higher incidence of fatal outcome.
17549302 Nuclear factor of activated T cells and early growth response 1 are required for tissue factor upregulation in response to vascular endothelial growth factor in endothelial cells.
17536017 identification of TF as an important mediator of C5a-induced oxidative burst in neutrophils in antiphospholipid antibody-induced fetal injury provides a new target for therapy to prevent pregnancy loss
17483700 The high levels of intravascular TF present in neonates (prior and after LPS-stimulation) might help to explain the clinically observed efficient clotting of cord blood despite low levels of procoagulatory factors.
17470200 factor VIIa-tissue factor, PAR1 and PAR2 have roles in transcription in tumor cell lines
17469034 An inadequate tissue factor pathway inhibitor (TFPI) concentration as a result of elevated tissue factor (TF):tissue factor pathway inhibitor (TFPI) ratio characterizes patients with clinical manifestations of nephrotic syndrome and mild proteinuria.
17459125 Semen contains factor VII/tissue factor, reinforcing the concept of an active clotting system in semen.
17401435 1alpha,25-(OH)2DHT(3) blocks TNF-induced monocytic tissue factor expression by inhibition of AP1 and NF-kappa B.
17384202 roles of PAR1 and PAR2 and F7 in tissue factor mobilization and endocytosis
17347408 human platelets not only assemble the clotting reactions on their membrane, but also supply their own TF for thrombin generation in a timely and spatially circumscribed process
17334638 Observational study of gene-disease association. (HuGE Navigator)
17331567 The association between TF and uPA/suPAR system is significantly related to the presence of cardiovascular disease in hemodialysis patients
17324918 The results suggest that estrogens may modulate T F expression and cytokine production by monocytes and may thus be involved, at least in part, in the pathophysiology of acute inflammatory processes associated with high estrogen levels.
17323935 These results suggest that both Arg-200 and Lys-201 of TF interact with EGF-1 domain of factor X to facilitate the optimal docking of the substrate into the catalytic groove of the protease in the activation complex.
17314141 monocyte-derived human dendritic cells stimulated with a P2X7 receptor (P2X7R) agonist undergo a large release of microparticles containing the membrane-bound form of tissue factor
17237436 SAA induced TF mRNA in PBMC within 30 min and optimal procoagulant activity within 4 h through activation of NF-kappaB via the ERK1/2 and p38 MAPK pathways. SAA-induced TF was partially inhibited by high-density lipoprotein.
17234207 down-regulation of urokinase plasminogen activator in female low-tissue factor mice protects them from more severe cardiac fibrosis
17200764 no pro-coagulant activity (FX activation, thrombin generation) of alternatively-spliced human tissue factor was observed on the surface, in lysates, and on microparticles from TF transfected cells.
17200762 review of properties of alternatively spliced tissue factor
17200119 local changes in phospholipid bilayer composition modulate the activity of the factor VIIa.tissue factor complex
17196206 atherosclerotic plaque tissue factor (TF) activity was higher in plaques from dyslipidemic patients than in non dyslipidemic ones.
17157899 The intersubject variability of F3 mRNA production in monocytes and its relation with TLR4 was studied.
17137581 The differential influence of TF is modified depending on the presence of other coagulation factors and ultimately acts as a deciding factor in the determination of cellular fate for vascular endothelial cells
17066404 High expression of tissue factor is associated with lymphatic metastasis and gastric cancer with intestinal phenotype
17060476 Platelet-derived tissue factor contributes to the propagation and stabilization of a thrombus.
17008590 Admission coagulation factor VII and tissue factor antigen levels, partially predicted by polymorphisms, are independent predictors of mortality and reinfarction in patients with acute myocardial infarction.
16959886 Data demonstrate that tissue factor-factor VIIa-mediated coagulation and cell signaling involve distinct cellular pools of tissue factor.
16949034 the inhibiting effect of celecoxib on endothelial TF expression does not extend to vascular smooth muscle cells
16937466 Results suggest that soluble tissue factor might contribute to activation of the coagulation system in pancreatic cancer.
16930953 Induction of macrophage TF expression by VT-1 may play an important role in the acceleration of the coagulation-inflammation-thrombosis circuit during infections by VT-producing E. coli.
16894464 formation of TF-FVIIa-FXa complex prevents apoptosis in breast cancer cells by a thrombin-independent pathway
16839353 FVIIa not only decreased thromboplastin sensitivity to plasma FVII, it surprisingly increased sensitivity to plasma levels of FV, FX and prothrombin.
16835245 Results indicate that proper positioning of the factor VII/VIIa binding site on tissue factor above the membrane surface is important for efficient rates of activation of factor X by this membrane-bound enzyme/cofactor complex.
16820938 Observational study of gene-disease association. (HuGE Navigator)
16794185 Paclitaxel increases endothelial TF expression via its stabilizing effect on microtubules and selective activation of JNK
16697385 This and other proagulants are strongly atherogenic and therefore we suggest a mechanism for the involvement of Chlamydia pneumoniae in the onset and progression of vascular disease.
16634740 the TF-1208 polymorphism is functional in that it regulates basal TF-mRNA in circulating monocytes and circulating microparticle-associated TF-procoagulant activity in vivo
16531802 Hypertensive individuals with carotid artherosclerosis had a significant increase in monocyte TF mRNA and activity levels compared with hypertensive individuals with no carotid lesions.
16529959 show that increasing the lipid surface area available to each TF:VIIa increases the apparent k(cat) and that it approaches a maximum asymptotically, exhibiting a K(1/2) at a 40 nm lipid radius; the binding parameters of Xa were determined
16516912 TF induction in conjunction with TFPI suppression may be relevant for the increased frequency of myocardial infarction observed in cocaine consumers
16510984 structure-based drug design of specific inhibitors for Factor VIIa/Tissue factor.
16507316 Among major red wine phenolics, quercetin appears to be the predominant suppressor of TF induction
16493499 hypothesize that granulocytes take-up TF for transport to other locations in order to initiate fibrin formation or to induce pro-inflammatory gene expression upon interaction with factor VIIa
16490369 review: tissue factor microparticles are present in a spectrum of cancer patients known to have a high incidence of thromboembolic complications
16488980 protein S, which is well known as the cofactor of activated protein C, specifically inhibits TF activity by promoting the interaction between full-length TF pathway inhibitor (TFPI) and factor Xa (FXa)
16473535 review of differential pathways involving activated platelets for the TF-mediated coagulation start in blood.
16453151 TF can promote immune evasion in tumour cells expressing this protein leading to increased survival and therefore metastatic rate in such cells
16363246 FVIIa/TF interaction on activated monocyte-derived macrophages could be relevant to prepare monocytes/macrophages for extravasation and may represent a novel amplification loop of leukocyte recruitment
16324758 A marker of endothelial damage/injury in the activation of vascular and coagulation abnormalities in acute coronary syndromes.
16239598 Observational study of gene-disease association. (HuGE Navigator)
16239598 The 5466 AG genotype is a novel predictor of cardiovascular death in acute coronary syndrome and may act through a high TF response
16236262 ability of epithelial cells to interact with the vascular system via expression of the TF gene (and other effectors) is under the control of complex alterations in cellular architecture
16217771 reports existence of novel TF transcript predominantly expressed in tumor cells; occurs as a result of alternative splicing and insertion of an additional exon
16215234 the transient, localized expression of TF is sufficient to sustain a TF-independent procoagulant response as long as flow persists
16182846 Transmembrane glycoprotein involved not only in the onset of the coagulation cascade, but also in cell proliferation and anti-apoptotic processes, may play a role in the development of alloantibody-induced chronic rejection.
16113838 EGF-mediated upregulation of TF results in its accumulation in caveolae-like membrane fractions and increased coagulative and invasive potential
16113798 human B lymphocytes can express a functional Tissue Factor in response to phorbol myristate acetate
16020745 MCP-1/CCR2 may play a role in Ca2+ influx-dependent TF regulation in the monocyte-endothelial cell interaction in the impairment of nitric oxide synthesis
15996056 CRP regulation of monocyte TF could contribute to the higher than expected atherosclerotic vascular disease seen in patients with inflammatory rheumatic disease
15935832 in a model system, TGF beta-1 released from activated platelets contributes to the hemostatic imbalance at the sinusoidal endothelium in patients with hepatic VOD by increase of endothelial cell PAI-1 production and TF expression.
15905465 tissue factor-mediated cellular signaling is relevant to cancer angiogenesis
15892865 Observational study of gene-disease association. (HuGE Navigator)
15869604 FVIIa induces PRIM1 and ensuing cellular proliferation via a TF- and of the PARs entirely PAR-2-dependent pathway, in distinction to that of thrombin which is PAR-1-dependent and TF-independent
15865421 Despite indistinguishable stability under physiological conditions of mutant tissue factor(R200W) and wild-type TF, important clues are revealed regarding misfolding and aggregation propensities of the mutant TF(R200W) to explain why it is lost in vivo.
15860742 The higher availability of surface TF antigen on mononuclear leukocytes from high responders and TF-containing microparticles might make these individuals more susceptible to hypercoagulation
15842359 TF is enhanced by Shiga toxin and has a role in the coagulopathy observed in hemolytic uremic syndrome
15835921 dissociation of fVIIai from TF occurred by a two-step mechanism
15814630 Tissue factor(TF) expression may contribute to the aggressiveness of pancreatic ductal adenocarcinoma by stimulating tumor invasiveness, and that evaluation of the primary tumor for TF expression may identify patients with a poor prognosis.
15630487 hyperchemotaxis towards PDGFRB is likely to depend in part on phosphorylation of the cytoplasmic domain of TF
15604222 the concentration of physiologically active TF in non-cytokine-stimulated blood from healthy individuals cannot exceed and is probably lower than 20 fM.
15562024 Progesterone-dependent up-regulation of tissue fasctor provides a survival advantage to burgeoning breast cancer cells.
15494427 Tissue factor expression by colorectal cancer cells appears to act as both a regulatory target and an important mediator of oncogene-driven tumor growth and neovascularization.
15467908 TF and TFPI mRNA expression, protein levels and activity in trophoblast cells were determined and compared to human umbilical vein endothelial cells
15328160 membrane cholesterol functions as a positive regulator of TF function by maintaining TF receptors, probably in noncaveolar lipid rafts, in a high-affinity state for VIIa binding
15304041 polymorphisms in the 5'-UTR of the tissue factor gene are associated with altered expression in human endothelial cells
15252050 Arg(74) mutant of TF was defective in enhancing both the amidolytic and proteolytic activity of fVIIa, suggesting that this residue may be required for the allosteric activation of the protease.
15242552 Data suggest that Rac-dependent activation of the NFkappaB pathway may be a critical element promoting thrombin-induced tissue factor expression and activity, and thus a prothrombotic state in pulmonary hypertension.
15213854 TF expression in leukocytes plays an important role in various diseases but the expression level does not always correlate with plasma levels of TF antigen
15213840 EGFR, PYK2, Yes, and SHP-2 are involved in transduction of the TF/FVIIa signal possibly via transactivation of the EGF receptor.
15182581 TF/FVIIa complex up-regulates the transcription of u-PAR in human ovarian cancer cells.
15161741 Pancreatic duct cells exert a potent factor VII-dependent procoagulant activity related to their expression of tissue factor.
15154603 the transfer of TF to monocytes is not simply an CD62P-mediated adhesion of platelets or platelet-derived microvesicles to monocytes, but may involve other not yet identified mechanisms
15117736 Review. This review focuses on the roles of TF in hemostasis, thrombosis, and vascular development.
15041276 some protease inhibitors might act as stress and induced TF expression with direct phosphorylation of JNK and p38, followed by phosphorylation and activation of AP-1 in monocytic cells
15034796 review: role of TF in hypercoagulability and clotting-dependent induction of tumor angiogenesis
15034795 review: role of TF up-regulation in cancer pathogenesis and tumor angiogenesis
15016732 FVIIa/TF-interaction produces STAT5 phosphorylation, STAT5 nuclear translocation and transactivation of a reporter gene.
14961150 The TF-603A/G gene promoter polymorphism significantly influences constitutive TF gene expression in human monocytes but has no major effect on TF gene expression or on whole blood coagulation time in LPS stimulated conditions.
14756558 Substitutions on the TF surface that contacts the protease domain of factor VIIa have nearly identical effects on the affinities for both factors VII and VIIa--hence zymogen VII can readily adopt a VIIa-like conformation required for binding to TF.
14750502 model characterizes likely enzyme-binding exosites on FVIIa and Xa that may be involved in the ternary complex (sTF-VIIa-Xa) formation and the membrane binding region of the ternary complex.
14738565 circulating microparticles from platelets, erythrocytes, and granulocytes exposed TF; microparticle-exposed TF antigen levels were higher in cardiac patients compared with healthy individuals.
14678810 Tissue factor expression induced by local inflammation is involved in the pathogenesis of thrombosis in patients with nonvalvular atrial fibrillation
14675093 superantigens from S. aureus activate the extrinsic coagulation pathway by inducing expression of TF in monocytes, and that the expression is mainly triggered by superantigen-induced IL-1 beta release
14675092 In response to endotoxin, there was an increase in IL-6, TF and CD11b expression and a procoagulant shift of clotting onset time, which was normalized by 4 mmol L-1 nicotinamide
14610342 The TF and TFPI levels depend significantly on the renal function; elevated TF and TFPI levels may be related to thrombosis and atherosclerosis in chronic renal failure patients on peritoneal dialysis
14597990 The ectopic expression of the acute promyelocytic leukemia-specific PML/RARalpha oncoprotein in U-937 cells results in induction of TF mRNA and promoter activity
12941032 demonstrate the occurrence of two forms of non-cell-bound TF. One form, which is microparticle-associated, supports thrombin generation via FVII. The other form, which is fluid-phase, does not stimulate thrombin formation
12920028 cell surface location-dependent phosphorylation of the TF cytoplasmic domain is regulated at multiple levels
12903530 TF may influence tumor growth and metastasis by modulating VEGF expression and neoangiogenesis.
12883669 tissue factor has a role in affecting proliferative ability in meningioma
12871349 review of role of tissue factor in thrombosis
12654807 M type 1 and 3 strains of group A streptococci are potent inducers of TF synthesis; findings suggest that a novel interaction between group A streptococci and host cells contributes to the observed coagulopathy in Strep toxic shock syndrome
12603864 These data support a transcriptional role for both nuclear factor-kappaB and p38 mitogen-activated protein kinase, but not MEK1, in tissue factor gene expression in human dermal microvascular endothelial cells.
12544727 The influence of several eicosanoids of the lipoxygenase pathway on regulation of LPS-induced tissue factor was examined in whole blood.
12540946 REVIEW: model of the intravascular TF pathway in which adhesive interactions of the TF bearing platelets and microvesicles to neutrophils and monocytes enable blood coagulation
12529356 the Gla and first epidermal growth factor-like domains of factor X play a role in the prothrombinase and tissue factor-factor VIIa complexes.
12514112 Tissue factor initiates blood coagulation via circulating microvesicles and platelets.
12426405 Mice expressing low levels of human TF in an mTF(-/-) background had significantly shorter lifespans than wild-type mice, in part, because of spontaneous fatal hemorrhages. Low-TF mice had a selective heart defect with hemosiderin deposition & fibrosis.
12408769 correlation between tissue factor (TF) expression and hepatic metastasis and prognosis in rectal cancer
12356487 REVIEW: role of tissue factor-FVIIa complex in pathophysiological processes and effect of the inhibitors of the tissue factor:factor VII pathway
12353085 15d-PGJ2 down-regulates LPS- and TNFalpha-induced TF activity through inhibition of TF gene transcription.
12270558 levels of tissue factor in placenta and myometrium, over tissue factor in blood plasma may be clinically significant in obstetrics, for instance, in the etiology of DIC in placental abruption
12192302 effect of platelet-derived CD40L on the tissue factor activity of human CD40-positive melanoma cells and monocytes
12189027 non-activated and activated platelets contain an inactive form of TF that may develop functional activity following its release
12172458 REVIEW:clotting-dependent and -independent mechanisms of TF-induced angiogenesis in cancer
12152682 a three-dimensional model of the ternary complex between FVIIa:TF:FIX was built using a full-space search algorithm in combination with computational graphics
12152652 tissue factor expression by LPS-stimulated human monocytes is inhibited by adenosine and involves the adenosine A3 receptor, specifically
12149215 data indicate that endothelial cell surface expression of TF and extrinsic clotting factors are critical in augmenting capillary leak following intravascular tumor necrosis factor administration
12095134 monocyte adhesion and transmigration induce tissue factor expression
12083501 expression on monocyte subpopulations during normal pregnancy
12083487 Tissue factor activity is upregulated in human endothelial cells exposed to oscillatory shear stress.
12070020 Thrombin functions studied during tissue factor-induced blood coagulation
12036889 Tissue factor is the receptor for plasminogen type 1 on 1-LN human prostate cancer cells; Plasminogen type 2, containing only one O-linked oligosaccharide chain, did not bind to tissue factor on 1-LN human prostate cancer cells
12028585 expression of TF and TFPI in human melanoma
12019261 TF cytoplasmic domain-independent stimulation of protein synthesis via activation of S6 kinase contributes to FVIIa effects in pathophysiology.
12008961 Fluvastatin upregulated IkappaB alpha in unstimulated as well as in TNFalpha-stimulated HUVEC cells and also impaired the TNFalpha-induced Cdc42 prenylation, indicating that fluvastatin interferes with transcriptional activation of tissue factor gene.
11994566 Enhanced monocyte tissue factor expression is implicated in the hemostatic diathesis characterizing hepatosplenic schistosomiasis.
11973337 signaling increased transcription as well as mRNA stabilization leading to up-regulation of interleukin-8 synthesis
11943929 TF-apoprotein selectively binds Hb, most probably via the carbohydrate moieties (alpha-d-glucosyl; alpha-d-mannosyl and N-acetyl-beta-d-glucosaminyl residues) of TF, and enhances its procoagulant activity.
11929768 Coronary no-reflow is caused by shedding of active tissue factor from dissected atherosclerotic plaque.
11921018 results suggest involvement of tissue factor in the process of metastasis and progression of colorectal cancer may depend on increased angiogenesis
11882315 differentiation of human monocytes into macrophages in culture enhances their tissue factor expression.
11876644 pH dependence of fVIIa amidolytic activity in complex with soluble tissue factor
11858480 In children with sepsis-induced multiple organ failure, a cytokine-associated increase in circulating TF and systemic activity was predicted. Increased TF was associated with the development of coagulopathy and tended to be associated with mortality.
11858185 Endothelin-1 enhances TF expression in monocytes from health individuals. No additional stimulation was seen in monocytes from heart failure subjects, who nonetheless have 2.5 times as much TF as controls.
11858183 Resveratrol does not inhibit the activation or translocation of NF-kappaB/Rel proteins but inhibits NF-kappaB/Rel-dependent transcription of the gene for TF by impairing the transactivation potential of p65.
11816709 TF promotes metastasis by a pathway that does not involve high expression of known PARs by tumor cells. PAR1 enhances the metastatic potential of cells with high TF expression.
11816707 tissue factor/tissue factor pathway inhibitor imbalance is associated with myocardial infarction at young age in Japanese men.
11776298 TF-FVIIa interaction elicits intracellular signalling events implicated in sepsis, inflammation, angiogenesis, metastasis and atherosclerosis. These include the sequential activation of Src-like kinases, MAP kinases, small GTPases and calcium signalling.
11744662 selective activation of NF-kappaB (p50/p65) during intensive physical exercise does not result in the expression
11583305 The complex between tissue factor and factor VIIa initiates coagulation and intracellular signaling, alters gene expression, and promotes metastasis.

AA Sequence

METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQI      1 - 70
STKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNL     71 - 140
GQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLID    141 - 210
VDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKA    211 - 280
GVGQSWKENSPLNVS                                                           281 - 295
//

Text Mined References (526)

PMID Year Title
27057091 2015 Tissue Factor in Dermatitis Herpetiformis and Bullous Pemphigoid: Link between Immune and Coagulation System in Subepidermal Autoimmune Bullous Diseases.
26797521 2016 The M358R variant of ?(1)-proteinase inhibitor inhibits coagulation factor VIIa.
26791271 2016 Yes-associated protein (YAP) signaling regulates lipopolysaccharide-induced tissue factor expression in human endothelial cells.
26731648 2016 Improving the Prediction of Prostate Cancer Overall Survival by Supplementing Readily Available Clinical Data with Gene Expression Levels of IGFBP3 and F3 in Formalin-Fixed Paraffin Embedded Core Needle Biopsy Material.
26694616 2016 Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26504080 2016 Mutant B-Raf(V600E) Promotes Melanoma Paracellular Transmigration by Inducing Thrombin-mediated Endothelial Junction Breakdown.
26471500 2016 Tissue factor expression by myeloid cells contributes to protective immune response against Mycobacterium tuberculosis infection.
26408927 2015 Tissue Factor: Old and New Links with Cancer Biology.
26408926 2015 Clinical Significance of Tissue Factor-Exposing Microparticles in Arterial and Venous Thrombosis.
26408925 2015 Tissue Factor Expressed by Neutrophils: Another Piece in the Vascular Inflammation Puzzle.
26408924 2015 Structure-Function Relationship of the Interaction between Tissue Factor and Factor VIIa.
26408922 2015 Cancer Tissue Procoagulant Mechanisms and the Hypercoagulable State of Patients with Cancer.
26408920 2015 Role of Tissue Factor in the Coagulation Network.
26408918 2015 The Role of Tissue Factor in Atherothrombosis and Coronary Artery Disease: Insights into Platelet Tissue Factor.
26408917 2015 "Soluble Tissue Factor" in the 21st Century: Definitions, Biochemistry, and Pathophysiological Role in Thrombus Formation.
26281862 2016 Tissue factor is unregulated in microvascular endothelial cells of patients with heart failure.
26271343 2015 Tissue factor/factor VIIa signalling promotes cytokine-induced beta cell death and impairs glucose-stimulated insulin secretion from human pancreatic islets.
26241501 2015 The key roles of complement and tissue factor in Escherichia coli-induced coagulation in human whole blood.
26221761 2016 Internalization of Tissue Factor-Rich Microvesicles by Platelets Occurs Independently of GPIIb-IIIa, and Involves CD36 Receptor, Serotonin Transporter and Cytoskeletal Assembly.
26179105 2015 Alternatively spliced tissue factor synergizes with the estrogen receptor pathway in promoting breast cancer progression.
26169722 2015 Tissue Factor Residues That Modulate Magnesium-Dependent Rate Enhancements of the Tissue Factor/Factor VIIa Complex.
26136249 2015 FXIa and platelet polyphosphate as therapeutic targets during human blood clotting on collagen/tissue factor surfaces under flow.
26065856 2015 Production of prostaglandin E2 induced by cigarette smoke modulates tissue factor expression and activity in endothelial cells.
26062685 2015 Human megakaryocytes confer tissue factor to a subset of shed platelets to stimulate thrombin generation.
26025445 2015 Diagnostic and prognostic utility of tissue factor for severe sepsis and sepsis-induced acute lung injury.
26018600 2015 How it all starts: Initiation of the clotting cascade.
25963480 2015 Levels of Alternatively Spliced Tissue Factor in the Plasma of Patients with Pancreatic Cancer May Help Predict Aggressive Tumor Phenotype.
25931463 2015 Circulating Tissue Factor Levels and Risk of Stroke: Findings From the EPICOR Study.
25923092 Tissue factor and other hemostatic parameters in patients with advanced peripheral artery disease after endovascular revascularization - search for hemostatic factors which indicate restenosis.
25903973 2015 Accumulation of tissue factor in endothelial cells induces cell apoptosis, mediated through p38 and p53 activation.
25881103 2015 NMMHC IIA inhibition impedes tissue factor expression and venous thrombosis via Akt/GSK3?-NF-?B signalling pathways in the endothelium.
25864889 2015 Shiga toxin-1 Decreases Endothelial Cell Tissue Factor Pathway Inhibitor Not Co-localized with Tissue Factor on the Cell Membrane.
25823853 2015 Microparticle source and tissue factor expression in pregnancy.
25683933 2015 Comparative analysis of MCP-1 and TF in elderly patients with acute exacerbations of COPD and its clinical significance.
25665657 2015 Association between micro particle-tissue factor activity, factor VIII activity and recurrent VTE in patients with acute pulmonary embolism.
25653143 2015 Tissue factor and Toll-like receptor (TLR)4 in hyperglycaemia-hyperinsulinaemia. Effects in healthy subjects, and type 1 and type 2 diabetes mellitus.
25631539 2015 Protein disulphide-isomerase A2 regulated intracellular tissue factor mobilisation in migrating human vascular smooth muscle cells.
25596265 2015 Excess of heme induces tissue factor-dependent activation of coagulation in mice.
25490770 2014 Receptor for advanced glycation end products - membrane type1 matrix metalloproteinase axis regulates tissue factor expression via RhoA and Rac1 activation in high-mobility group box-1 stimulated endothelial cells.
25465717 2015 Mechanism of tissue factor production by monocytes stimulated with neutrophil elastase.
25463083 2014 MicroRNA-223 inhibits tissue factor expression in vascular endothelial cells.
25450387 2014 The contribution of tumor and host tissue factor expression to oncogene-driven gliomagenesis.
25427791 2015 The correlation between plasma tissue factor and interleukin 18 and their significance in patients with acute coronary syndrome.
25425620 2015 Angiogenic microvascular endothelial cells release microparticles rich in tissue factor that promotes postischemic collateral vessel formation.
25407675 2014 Genetic variation in the tissue factor gene is associated with clinical outcome in severe sepsis patients.
25403348 2015 Tissue factor activates allosteric networks in factor VIIa through structural and dynamic changes.
25312727 2015 Tissue factor and atherothrombosis.
25281742 2014 The Eph tyrosine kinase receptors EphB2 and EphA2 are novel proteolytic substrates of tissue factor/coagulation factor VIIa.
25262106 2014 Microparticle-associated tissue factor activity in patients with acute unprovoked deep vein thrombosis and during the course of one year.
25242242 2014 Alpha-1 proteinase inhibitor M358R reduces thrombin generation when displayed on the surface of cells expressing tissue factor.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25171777 2014 Endothelial connexin 32 regulates tissue factor expression induced by inflammatory stimulation and direct cell-cell interaction with activated cells.
25163770 2014 Inhibition of tissue factor:factor VIIa-catalyzed factor IX and factor X activation by TFPI and TFPI constructs.
25116956 2014 Alternatively spliced tissue factor promotes plaque angiogenesis through the activation of hypoxia-inducible factor-1? and vascular endothelial growth factor signaling.
25038529 2014 Epigenetic regulation of tissue factor inducibility in endothelial cell senescence.
24998411 2014 MicroRNA-19b functions as potential anti-thrombotic protector in patients with unstable angina by targeting tissue factor.
24966616 2014 Clinical significance of expression of tissue factor and tissue factor pathway inhibitor in ulcerative colitis.
24920554 2014 Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma.
24759146 2014 Coagulation in liver toxicity and disease: role of hepatocyte tissue factor.
24755284 2014 Tissue factor predicts response to chemotherapy in esophageal cancer.
24568471 2014 Effects of tissue factor, PAR-2 and MMP-9 expression on human breast cancer cell line MCF-7 invasion.
24516673 2014 Tissue factor residues that putatively interact with membrane phospholipids.
24470301 2014 Circulating microparticle tissue factor activity is increased in patients with cirrhosis.
24448154 2014 Genetic polymorphisms and plasma levels of tissue factor and tissue factor pathway inhibitor in venous thromboembolism.
24385191 2014 Tissue factor inflammatory response regulated by promoter genotype and p38 MAPK in neonatal vs. adult microvascular endothelial cells.
24378263 Diabetes worsening of hepatitis C cirrhosis: are alterations in monocytic tissue factor (CD 142) is the cause?
24342062 2015 PECAM-1 phosphorylation and tissue factor expression in HUVECs exposed to uniform and disturbed pulsatile flow and chemical stimuli.
24108579 2014 Extracellular haemoglobin upregulates and binds to tissue factor on macrophages: implications for coagulation and oxidative stress.
24094893 2013 Tumour expresion of tissue factor and tissue factor pathway inhibitor in ovarian cancer- relationship with venous thrombosis risk.
24021283 2013 p27(Kip1) inhibits tissue factor expression.
23803674 2013 Circulating microparticles of glial origin and tissue factor bearing in high-grade glioma: a potential prothrombotic role.
23801760 2013 Alternatively spliced tissue factor promotes breast cancer growth in a ?1 integrin-dependent manner.
23798713 2013 Tumor-derived tissue factor-positive microparticles and venous thrombosis in cancer patients.
23754313 2014 Alternatively spliced tissue factor contributes to tumor spread and activation of coagulation in pancreatic ductal adenocarcinoma.
23666757 2013 MicroRNA-19a targets tissue factor to inhibit colon cancer cells migration and invasion.
23640483 2013 4-Hydroxy-2-nonenal enhances tissue factor activity in human monocytic cells via p38 mitogen-activated protein kinase activation-dependent phosphatidylserine exposure.
23623171 2013 Human platelets do not express tissue factor.
23621622 2013 Analysis of tissue factor expression in various cell model systems: cryptic vs. active.
23604472 2013 Regulation of pro-angiogenic tissue factor expression in hypoxia-induced human lung cancer cells.
23585459 2013 Physiological levels of blood coagulation factors IX and X control coagulation kinetics in an in vitro model of circulating tissue factor.
23578769 2013 Procoagulant tissue factor-exposing vesicles in human seminal fluid.
23539451 2013 Endothelial cell protein C receptor opposes mesothelioma growth driven by tissue factor.
23524311 2013 Expression of tissue factor and tissue factor pathway inhibitor in microparticles and subcellular fractions of normal and malignant prostate cell lines.
23490466 2013 Tissue factor expression in rheumatoid synovium: a potential role in pannus invasion of rheumatoid arthritis.
23434438 2013 Disulfide reduction abolishes tissue factor cofactor function.
23409769 2013 Early growth response gene-1 and hypoxia-inducible factor-1? affect tumor metastasis via regulation of tissue factor.
23381943 2013 Ischemic stroke is associated with the ABO locus: the EuroCLOT study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23373413 2012 [Tissue factor in endothelial cells--its structure and function according to the current literature].
23325480 2013 Tissue factor de-encryption, thrombus formation, and thiol-disulfide exchange.
23294934 2013 A new regulatory function of activated factor V: inhibition of the activation by tissue factor/factor VII(a) of factor X.
23223577 2013 Thioredoxin and thioredoxin reductase control tissue factor activity by thiol redox-dependent mechanism.
23152142 2013 Enhanced binding of tissue factor-microparticles to collagen-IV and fibronectin leads to increased tissue factor activity in vitro.
23118232 2012 Cancer cells induced to express mesenchymal phenotype release exosome-like extracellular vesicles carrying tissue factor.
23065128 2013 Tissue factor signals airway epithelial basal cell survival via coagulation and protease-activated receptor isoforms 1 and 2.
23038262 2012 p21-activated kinase-1 signaling regulates transcription of tissue factor and tissue factor pathway inhibitor.
23029190 2012 Mycobacterium tuberculosis infection and tissue factor expression in macrophages.
23029002 2012 Autophagy mediates the delivery of thrombogenic tissue factor to neutrophil extracellular traps in human sepsis.
23007470 2012 Tissue factor regulates tumor angiogenesis of retinoblastoma via the extracellular signal-regulated kinase pathway.
22964479 2013 Anti-?(2)GPI/?(2)GPI induced TF and TNF-? expression in monocytes involving both TLR4/MyD88 and TLR4/TRIF signaling pathways.
22828416 2012 Tissue factor-bearing exosome secretion from human mechanically stimulated bronchial epithelial cells in vitro and in vivo.
22784289 2012 Tissue factor-Akt signaling triggers microvessel formation.
22771387 2012 TGF-?1 induces tissue factor expression in human lung fibroblasts in a PI3K/JNK/Akt-dependent and AP-1-dependent manner.
22705067 2013 Tissue factor exposing microparticles in inflammatory bowel disease.
22683021 2012 Inhibition of tissue factor by ixolaris reduces primary tumor growth and experimental metastasis in a murine model of melanoma.
22682138 2012 Tissue factor isoforms in cancer and coagulation: may the best isoform win.
22682123 2012 Tissue factor proangiogenic signaling in cancer progression.
22672593 2012 The role of tissue factor and protease-activated receptor 2 in endometriosis.
22547577 2012 Tumor-derived tissue factor activates coagulation and enhances thrombosis in a mouse xenograft model of human pancreatic cancer.
22461171 2012 Preeclampsia: the role of tissue factor and tissue factor pathway inhibitor.
22437887 2012 Caffeine induces endothelial tissue factor expression via phosphatidylinositol 3-kinase inhibition.
22340074 2012 Genetic variation in F3 (tissue factor) and the risk of incident venous thrombosis: meta-analysis of eight studies.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
22237453 2012 Inducible expression of tissue factor in small-cell lung cancer: impact on morphology and matrix metalloproteinase secretion.
22214850 2012 Monocyte tissue factor-dependent activation of coagulation in hypercholesterolemic mice and monkeys is inhibited by simvastatin.
22212466 2013 Bivalirudin inhibits periprocedural platelet function and tissue factor expression of human smooth muscle cells.
22196362 2012 Anti-phospholipid antibodies contribute to arteriosclerosis in patients with systemic lupus erythematosus through induction of tissue factor expression and cytokine production from peripheral blood mononuclear cells.
22187432 2012 Membrane binding events in the initiation and propagation phases of tissue factor-initiated zymogen activation under flow.
22178066 2012 Circulating monocytes mirror the imbalance in TF and TFPI expression in carotid atherosclerotic plaques with lipid-rich and calcified morphology.
22156911 2012 Increased platelet and microparticle activation in HIV infection: upregulation of P-selectin and tissue factor expression.
22119392 2012 BMP-2 inhibits TF expression in human monocytes by shutting down MAPK signaling and AP-1 transcriptional activity.
22115773 2012 Substance P-neurokinin-1 receptor interaction upregulates monocyte tissue factor.
22099707 2012 Circulating tissue factor positive microparticles in patients with acute recurrent deep venous thrombosis.
22076613 2012 Tissue factor/activated factor VIIa induces matrix metalloproteinase-7 expression through activation of c-Fos via ERK1/2 and p38 MAPK signaling pathways in human colon cancer cell.
22066736 2012 Evolutionary conservation of the tissue factor disulfide bonds and identification of a possible oxidoreductase binding motif.
22022598 2011 Syncytiotrophoblast microvesicles released from pre-eclampsia placentae exhibit increased tissue factor activity.
21934552 2012 RNA interference characterization of proteins discovered by proteomic analysis of pancreatic cancer reveals function in cell growth and survival.
21868706 2011 Tissue factor regulates microvessel formation and stabilization by induction of chemokine (C-C motif) ligand 2 expression.
21800004 2011 Dose-dependent decrease of platelet activation and tissue factor by omega-3 polyunsaturated fatty acids in patients with advanced chronic heart failure.
21762960 2012 Anthracycline treatment of the human monocytic leukemia cell line THP-1 increases phosphatidylserine exposure and tissue factor activity.
21737126 2012 Pre-analytical and analytical variables affecting the measurement of plasma-derived microparticle tissue factor activity.
21694469 2010 Correlation of D dimer and factor VIII levels with histopathology in patients with breast carcinoma.
21693061 2011 Expression of tissue factor in adenocarcinoma and squamous cell carcinoma of the uterine cervix: implications for immunotherapy with hI-con1, a factor VII-IgGFc chimeric protein targeting tissue factor.
21690060 2011 [Effect of simulated microgravity on human monocytic cell proliferation and tissue factor mRNA expression].
21652710 2011 The P2Y(2) nucleotide receptor mediates tissue factor expression in human coronary artery endothelial cells.
21625939 2011 Involvement of ERK1/2/NF-?B signal transduction pathway in TF/FVIIa/PAR2-induced proliferation and migration of colon cancer cell SW620.
21621407 2011 The inhibition of pancreatic cancer invasion-metastasis cascade in both cellular signal and blood coagulation cascade of tissue factor by its neutralisation antibody.
21619686 2011 Small interference RNA targeting tissue factor inhibits human lung adenocarcinoma growth in vitro and in vivo.
21617868 2011 Tissue factor is involved in retinoblastoma cell proliferation via both the Akt and extracellular signal-regulated kinase pathways.
21605334 2011 Statins prevent tissue factor induction by protease-activated receptors 1 and 2 in human umbilical vein endothelial cells in vitro.
21592524 2011 Varying effects of hemodynamic forces on tissue factor RNA expression in human endothelial cells.
21543928 2011 Tissue factor-factor VIIa complex induces epithelial ovarian cancer cell invasion and metastasis through a monocytes-dependent mechanism.
21535396 2011 Glycosylation of tissue factor is not essential for its transport or functions.
21531894 2011 Endothelin-1 signaling promotes fibrosis in vitro in a bronchopulmonary dysplasia model by activating the extrinsic coagulation cascade.
21518473 2011 [Expression of alternatively spliced human tissue factor in acute leukemia cells].
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21500176 2011 Circulating tissue factor and microparticles are not increased in patients with deep vein thrombosis.
21488215 2011 [Effect of tissue factor in extravascular migration of fibrosarcoma cells].
21483174 2011 Upregulation of monocyte tissue factor activity is significantly associated with carotid intima-media thickness in patients with metabolic syndrome.
21474669 2011 Activated protein C up-regulates procoagulant tissue factor activity on endothelial cells by shedding the TFPI Kunitz 1 domain.
21467727 2011 Dose-dependent modulation of tissue factor protein and procoagulant activity in human monocyte-derived macrophages by oxidized low density lipoprotein.
21464728 2011 Expression of tissue factor and heparanase in endometrial clear cell carcinoma: possible role for tissue factor in thromboembolic events.
21458031 2011 All trans-retinoic acid modulates the procoagulant activity of human breast cancer cells.
21404058 2011 Mutations of p53 and K-ras correlate TF expression in human colorectal carcinomas: TF downregulation as a marker of poor prognosis.
21367569 2011 Laminar shear, but not orbital shear, has a synergistic effect with thrombin stimulation on tissue factor expression in human umbilical vein endothelial cells.
21344386 2011 Progesterone utilizes distinct membrane pools of tissue factor to increase coagulation and invasion and these effects are inhibited by TFPI.
21310953 2011 Regulation of the incorporation of tissue factor into microparticles by serine phosphorylation of the cytoplasmic domain of tissue factor.
21293108 2010 Plasma tissue factor levels and salivary tissue factor activities of periodontitis patients with and without cardiovascular disease.
21269460 2011 Initial characterization of the human central proteome.
21248061 2011 Cell-derived vesicles exposing coagulant tissue factor in saliva.
21245964 2011 Tissue factor expression in human pterygium.
21236471 2011 Activated factor XI and tissue factor in chronic obstructive pulmonary disease: links with inflammation and thrombin generation.
21186047 2011 Gene expression analysis of HUVEC in response to TF-binding.
21182229 2010 Tissue factor in predicted severe acute pancreatitis.
21160057 2011 Cortactin activation by FVIIa/tissue factor and PAR2 promotes endothelial cell migration.
21149441 2011 The endothelial protein C receptor supports tissue factor ternary coagulation initiation complex signaling through protease-activated receptors.
21129276 2010 [Preliminary study on role of endothelial cells and tissue factor in graft-versus-host disease].
21091668 2011 Toll-like receptor (TLR)-4 mediates anti-?2GPI/?2GPI-induced tissue factor expression in THP-1 cells.
21059650 2011 MicroRNA-19 (miR-19) regulates tissue factor expression in breast cancer cells.
21042291 2011 Evidence for enhanced tissue factor expression in age-related macular degeneration.
21037076 2010 The coagulation system contributes to alphaVbeta6 integrin expression and liver fibrosis induced by cholestasis.
20978007 2011 Sirt1 inhibition promotes in vivo arterial thrombosis and tissue factor expression in stimulated cells.
20933205 2010 Tissue factor in cardiovascular disease pathophysiology and pharmacological intervention.
20930172 2010 Activation of protease-activated receptors 3 and 4 accelerates tissue factor-induced thrombin generation on the surface of vascular smooth muscle cells.
20846886 2010 Tissue factor expression on monocytes from patients with severe dengue fever.
20830515 2011 Anti-tissue factor short hairpin RNA inhibits breast cancer growth in vivo.
20810696 2011 TWEAK-Fn14 interaction enhances plasminogen activator inhibitor 1 and tissue factor expression in atherosclerotic plaques and in cultured vascular smooth muscle cells.
20708733 2010 Tissue Factor-Factor VIIa complex induces cytokine expression in coronary artery smooth muscle cells.
20708219 2010 Plasma levels of microparticle-associated tissue factor activity in patients with clinically suspected pulmonary embolism.
20688968 2010 No evidence for tissue factor on platelets.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20656331 2010 Bone morphogenetic protein -7 increases thrombogenicity of lipid-rich atherosclerotic plaques via activation of tissue factor.
20634491 2010 Heparanase enhances the generation of activated factor X in the presence of tissue factor and activated factor VII.
20628259 2011 Tissue factor is induced by resistin in human coronary artery endothelial cells by the NF-?B-dependent pathway.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616308 2010 Induction of endothelial cell proliferation by recombinant and microparticle-tissue factor involves beta1-integrin and extracellular signal regulated kinase activation.
20605795 2010 Binding of anti-GRP78 autoantibodies to cell surface GRP78 increases tissue factor procoagulant activity via the release of calcium from endoplasmic reticulum stores.
20601186 2010 Apoptosis signal-regulating kinase 1-mediated signaling pathway regulates lipopolysaccharide-induced tissue factor expression in pulmonary microvasculature.
20589316 2010 Apixaban, a direct factor Xa inhibitor, inhibits tissue-factor induced human platelet aggregation in vitro: comparison with direct inhibitors of factor VIIa, XIa and thrombin.
20553947 2010 Modulation of the oncogene-dependent tissue factor expression by kinase suppressor of ras 1.
20546120 2010 Tissue factor up-regulation in proinflammatory conditions confers thrombin generation capacity to endothelial colony-forming cells without influencing non-coagulant properties in vitro.
20524980 2010 Characterization of canine coagulation factor VII and its complex formation with tissue factor: canine-human cross-species compatibility.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20451919 2011 Factor Xa induces tissue factor expression in endothelial cells by P44/42 MAPK and NF-?B-dependent pathways.
20434015 2010 Predictive value of tissue factor bearing microparticles in cancer associated thrombosis.
20434004 2010 Role of the tissue factor pathway in the biology of tumor initiating cells.
20434002 2010 Tissue factor in cancer progression and angiogenesis.
20388709 2010 Engineering of substrate selectivity for tissue factor.factor VIIa complex signaling through protease-activated receptor 2.
20338779 2010 Thromboplastin standards.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237315 2010 Cystine 186-cystine 209 disulfide bond is not essential for the procoagulant activity of tissue factor or for its de-encryption.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
20224254 2007 The relation between plasma tissue factor and oxidized LDL levels in acute coronary syndromes.
20189224 2010 Analysis of tissue factor positive microparticles.
20185792 2010 Acadesine inhibits tissue factor induction and thrombus formation by activating the phosphoinositide 3-kinase/Akt signaling pathway.
20171716 2010 Tissue factor microparticles and haemophilia.
20163832 2010 Role of PDI in regulating tissue factor: FVIIa activity.
20156644 2010 Recent estimates of the structure of the factor VIIa (FVIIa)/tissue factor (TF) and factor Xa (FXa) ternary complex.
20153879 2010 Current status on tissue factor activation of factor VIIa.
20150920 2010 A functional polymorphism (-603A --> G) in the tissue factor gene promoter is associated with adult-onset asthma.
20149924 2010 Tissue factor activity under flow.
20149415 2010 Tissue factor expression in blood cells.
20142117 2010 Efficacy of simvastatin or ezetimibe on tissue factor, von Willebrand's factor and C-reactive protein in patients with hypercholesterolaemia.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20138335 2010 Posttranslational modifications and activity of natural and recombinant tissue factor.
20133705 2010 PML/RARalpha fusion protein transactivates the tissue factor promoter through a GAGC-containing element without direct DNA association.
20113254 2010 Tissue factor +5466A>G and -1208D>I genetic polymorphisms and severity of rheumatoid arthritis.
20103969 2010 Upregulation of monocyte tissue factor activity is significantly associated with low-grade chronic inflammation and insulin resistance in patients with metabolic syndrome.
20062929 2010 Inhibition of acute vascular thrombosis in chimpanzees by an anti-human tissue factor antibody targeting the factor X binding site.
20061396 2010 Phospholipid-esterified eicosanoids are generated in agonist-activated human platelets and enhance tissue factor-dependent thrombin generation.
20034913 2009 [Dynamic changes of plasma tissue factor and tissue factor pathway inhibitor-1 and their clinical significance in patients with multiple traumas].
19995406 2010 Tumor expression of alternatively spliced tissue factor is a prognostic marker in non-small cell lung cancer.
19966052 2010 Upregulation of tissue factor in monocytes by cleaved high molecular weight kininogen is dependent on TNF-alpha and IL-1beta.
19958818 2010 Inhibition of tissue factor/protease-activated receptor-2 signaling limits proliferation, migration and invasion of malignant glioma cells.
19954621 2009 [Pathogenetic role of tissue factor in endothelial-injury in graft-versus-host disease].
19923558 2009 What is wrong with the allosteric disulfide bond hypothesis?
19914247 2010 Opposing and uncoupling effects of mTOR and S6K1 in the regulation of endothelial tissue factor expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19904262 2009 Self-production of tissue factor-coagulation factor VII complex by ovarian cancer cells.
19880163 2010 Tissue factor-induced thrombin generation in the fasting and postprandial state among elderly survivors of myocardial infarction.
19861441 2009 Tumor-derived tissue factor-bearing microparticles are associated with venous thromboembolic events in malignancy.
19856410 2010 Tissue factor -1208D>I polymorphism is associated with D-dimer levels in patients with inflammatory bowel disease.
19843576 2010 Antagonistic roles of four SR proteins in the biosynthesis of alternatively spliced tissue factor transcripts in monocytic cells.
19829668 2009 [Ectopic expression and clinical significance of tissue factor/coagulation factor VII complex in colorectal cancer].
19828697 2010 Increased tissue factor expression on circulating monocytes in chronic HIV infection: relationship to in vivo coagulation and immune activation.
19817993 2009 Aggregated low density lipoprotein induces tissue factor by inhibiting sphingomyelinase activity in human vascular smooth muscle cells.
19806259 2009 Tissue factor activity of blood mononuclear cells is increased after total knee arthroplasty.
19795460 2010 Evidence for tissue factor phosphorylation and its correlation with protease-activated receptor expression and the prognosis of primary breast cancer.
19750223 2009 Shiga toxin and lipopolysaccharide induce platelet-leukocyte aggregates and tissue factor release, a thrombotic mechanism in hemolytic uremic syndrome.
19698254 2009 [Correlation analysis of tissue factor promotor polymorphism -1208I/D and venous thromboembolism].
19661141 2009 Increased tissue factor expression is associated with reduced survival in non-small cell lung cancer and with mutations of TP53 and PTEN.
19631649 2009 CRP regulates the expression and activity of tissue factor as well as tissue factor pathway inhibitor via NF-kappaB and ERK 1/2 MAPK pathway.
19628788 2009 Tissue factor and cancer stem cells: is there a linkage?
19604541 2009 The effects of twelve representative flavonoids on tissue factor expression in human monocytes: structure-activity relationships.
19597299 2009 Role of the phosphatidylinositol 3-kinase/protein kinase B pathway in regulating alternative splicing of tissue factor mRNA in human endothelial cells.
19592470 2009 Tissue factor in coagulation: Which? Where? When?
19583819 2009 Tissue factor gene polymorphisms and haplotypes and the risk of ischemic vascular events: four studies and a meta-analysis.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19572083 2009 Tissue factor +5466A>G polymorphism predicts plasma TF levels in subjects with cryptogenic ischaemic stroke.
19561489 2009 Relative contributions of collagen and tissue factor to thrombus formation on damaged vascular vessels: in-vitro studies with circulating blood.
19558505 2009 Increased expression of TF on monocytes, but decreased numbers of TF bearing microparticles in blood from patients with acute myocardial infarction.
19545871 2009 Tissue factor genetic polymorphisms and haplotypes in Japanese population.
19541671 2009 Serotonin enhances platelet procoagulant properties and their activation induced during platelet tissue factor uptake.
19515372 2009 Tissue factor gene promoter haplotype associates with carotid intima-media thickness in subjects in cardiovascular risk prevention.
19500510 2009 [Effects of serum of patients with MODS on TF and PAI-1 secretion of human vascular endothelial cells during CRRT].
19492160 2009 Tissue factor procoagulant activity of plasma microparticles is increased in patients with early-stage prostate cancer.
19483295 2009 [Plasma tissue factor and serum angiotensin II and the therapeutic effect of different dosages of fosinopril on chronic heart failure].
19428056 2010 Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient.
19424642 2009 Evidence for increased expression of tissue factor and protease-activated receptor-1 in human esophageal cancer.
19359592 2009 c-Met activation in medulloblastoma induces tissue factor expression and activity: effects on cell migration.
19356953 2009 Elevated tissue expression of thrombomodulatory factors correlates with acute symptomatic carotid plaque phenotype.
19350119 2009 Microparticle-linked tissue factor activity and increased thrombin activity play a potential role in fibrinolysis failure in ST-segment elevation myocardial infarction.
19290852 2009 Coagulation and fibrinolysis related cytokine imbalance in preeclampsia: the role of placental trophoblasts.
19276228 2009 Progestin and thrombin regulate tissue factor expression in human term decidual cells.
19249541 The influence of brain death on tissue factor expression in the pancreatic tissues and isolated islets in rats.
19234141 2009 Pravastatin prevents miscarriages in mice: role of tissue factor in placental and fetal injury.
19219655 2009 Tissue factor and VEGF expression in prostate carcinoma: a tissue microarray study.
19203804 2011 Very rare minor homozygous GG genotype of tissue factor +5466A>G mutation in a patient with two cryptogenic cerebrovascular ischemic events.
19168442 2009 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
19167713 2009 Asymmetric dimethylarginine induces tissue factor expression in monocytes via NF-kappaB-dependent pathway: Role in acute coronary syndromes.
19167313 2009 Loop dynamics of the extracellular domain of human tissue factor and activation of factor VIIa.
19149969 2008 Melagatran prevents tissue factor expression in human platelet-monocyte heterotypic complexes.
19132232 2008 Modulation of tissue factor and tissue factor pathway inhibitor-1 by neutrophil proteases.
19105796 2008 Tissue factor as an initiator of coagulation and inflammation in the lung.
19099647 2008 [Expression and activity of membrane surface tissue factor in peripheral blood cells of patients with cerebral infarction].
19095643 2009 NF-kappaB transcription factor p50 critically regulates tissue factor in deep vein thrombosis.
19091315 2009 Increased levels of procoagulant tissue factor-bearing microparticles within the occluded coronary artery of patients with ST-segment elevation myocardial infarction: role of endothelial damage and leukocyte activation.
19065458 2008 Tissue factor and its natural inhibitor in pre-eclampsia and SGA.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19027114 2009 Tissue factor +5466A>G polymorphism determines thrombin formation following vascular injury and thrombin-lowering effects of simvastatin in patients with ischemic heart disease.
19012190 2008 A link between a hemostatic disorder and preterm PROM: a role for tissue factor and tissue factor pathway inhibitor.
19002040 2008 Mechanisms of action of recombinant activated factor VII in the context of tissue factor concentration and distribution.
18989544 2008 The increase in tissue factor-bearing leukocytes after off-pump coronary artery bypass surgery.
18983524 2008 Heme induces endothelial tissue factor expression: potential role in hemostatic activation in patients with hemolytic anemia.
18983503 2009 Insulin inhibits tissue factor expression in monocytes.
18983492 2009 Plasmin enhances cell surface tissue factor activity in mesothelial and endothelial cells.
18983479 2009 Mitochondrial reactive oxygen species: a common pathway for PAR1- and PAR2-mediated tissue factor induction in human endothelial cells.
18848323 2009 Prothrombotic genetic variants and atherosclerosis in patients with cerebral ischemia of arterial origin.
18846330 2008 Homocysteine-induced enhanced expression of tissue factor in human vascular smooth muscle cells.
18835104 2009 Pulmonary tumor thrombotic microangiopathy caused by an ovarian cancer expressing tissue factor and vascular endothelial growth factor.
18802362 2009 Expression of tissue factor by eosinophils in patients with chronic urticaria.
18677291 2008 Tissue factor, tissue pathway factor inhibitor and risk factors of atherosclerosis in patients with chronic limbs ischemia: preliminary study.
18665928 2008 No evidence for the presence of tissue factor in high-purity preparations of immunologically isolated eosinophils.
18665396 2008 Downregulation of tissue factor (TF) by RNA interference induces apoptosis and impairs cell survival of primary endothelium and tumor cells.
18645927 2008 Hypercoagulability and tissue factor gene upregulation in hematologic malignancies.
18642055 2009 The relationship between gender and age with monocyte tissue factor expression.
18641355 2008 Activated protein C up-regulates IL-10 and inhibits tissue factor in blood monocytes.
18612547 2008 Formation of tissue factor-factor VIIa-factor Xa complex induces activation of the mTOR pathway which regulates migration of human breast cancer cells.
18508060 2009 Increased expression of C-reactive protein and tissue factor in acute coronary syndrome lesions: Correlation with serum C-reactive protein, angioscopic findings, and modification by statins.
18495150 2008 Viral myocarditis and coagulopathy: increased tissue factor expression and plasma thrombogenicity.
18490736 2008 C5a and TNF-alpha up-regulate the expression of tissue factor in intra-alveolar neutrophils of patients with the acute respiratory distress syndrome.
18449421 2008 Microparticle-associated vascular adhesion molecule-1 and tissue factor follow a circadian rhythm in healthy human subjects.
18363812 2008 Tissue factor and IL8 production by P-selectin-dependent platelet-monocyte aggregates in whole blood involves phosphorylation of Lyn and is inhibited by IL10.
18327399 2008 The interaction of fragment 1 of prothrombin with the membrane surface is a prerequisite for optimum expression of factor Va cofactor activity within prothrombinase.
18315555 2008 SR proteins ASF/SF2 and SRp55 participate in tissue factor biosynthesis in human monocytic cells.
18310227 2008 Intra-alveolar tissue factor pathway inhibitor is not sufficient to block tissue factor procoagulant activity.
18308368 2008 Leptin induces the expression of functional tissue factor in human neutrophils and peripheral blood mononuclear cells through JAK2-dependent mechanisms and TNFalpha involvement.
18297283 2008 Investigation of the mechanisms of tissue factor-mediated evasion of tumour cells from cellular cytotoxicity.
18292391 2008 Tissue factor in patients with acute coronary syndromes: expression in platelets, leukocytes, and platelet-leukocyte aggregates.
18284603 2008 Human urotensin II induces tissue factor and cellular adhesion molecules expression in human coronary endothelial cells: an emerging role for urotensin II in cardiovascular disease.
18278454 2008 Down-regulation of tissue factor by siRNA increased doxorubicin-induced apoptosis in human neuroblastoma.
18278195 2008 Monitoring high-dose heparinization during cardiopulmonary by-pass--a comparison between prothrombinase-induced clotting time (PiCT) and two chromogenic anti-factor Xa activity assays.
18217146 2008 Factor XIa and tissue factor activity in patients with coronary artery disease.
18180609 2008 Study of factor VII, tissue factor pathway inhibitor and monocyte tissue factor in noninsulin-dependent diabetes mellitus.
18091328 2008 Expression of tissue factor in prostate cancer correlates with malignant phenotype.
18031796 2008 Simvastatin induces apoptosis in human breast cancer cells in a NFkappaB-dependent manner and abolishes the anti-apoptotic signaling of TF/FVIIa and TF/FVIIa/FXa.
18029910 2007 Cardiac glycosides regulate endothelial tissue factor expression in culture.
18023707 2007 Alternatively spliced human tissue factor promotes tumor growth and angiogenesis in a pancreatic cancer tumor model.
18019946 2007 Tissue factor in thrombosis and hemorrhage.
18005233 2008 Expression of human tissue factor under the control of the mouse tissue factor promoter mediates normal hemostasis in knock-in mice.
18000605 2007 Factor VIIa and tissue factor procoagulant activity in diabetes mellitus after acute ischemic stroke: impact of hyperglycemia.
17991872 2008 TF/FVIIa transactivate PDGFRbeta to regulate PDGF-BB-induced chemotaxis in different cell types: involvement of Src and PLC.
17982314 2007 Increase in expression of monocytic tissue factor (CD142) with monocytes and blood platelet activation in liver cirrhosis.
17977694 2008 Relationship between heart rate variability, interleukin-6, and soluble tissue factor in healthy subjects.
17947506 2008 Granulocytes do not express but acquire monocyte-derived tissue factor in whole blood: evidence for a direct transfer.
17939398 2007 [Regulation of tissue factor expression by anti-oncogene PTEN in human neuroblastoma cell line].
17938822 2007 Factor VIIa/tissue factor-dependent gene regulation and pro-coagulant activity: effect of factor VIIa concentration.
17922809 2007 Chemotherapy-induced thrombin generation via procoagulant endothelial microparticles is independent of tissue factor activity.
17920661 2008 Suppression of HUVEC tissue factor synthesis by antisense oligodeoxynucleotide.
17901245 2008 Inhibition of tissue factor signaling suppresses tumor growth.
17900273 2007 High tissue factor-expressing human monocytes carry low surface CD36: application to intersubject variability.
17898544 2008 The influence of exogenous tissue factor on the regulators of proliferation and apoptosis in endothelial cells.
17883595 2007 Elevated tissue factor procoagulant activity in CD133-positive cancer cells.
17883594 2007 Tissue factor-dependent blood coagulation is enhanced following delivery irrespective of the mode of delivery.
17852460 2007 Procoagulant factors in patients with cancer.
17848177 2007 Tissue factor induction by protease-activated receptor 1 requires intact caveolin-enriched membrane microdomains in human endothelial cells.
17726162 2007 Tissue factor activation: is disulfide bond switching a regulatory mechanism?
17724132 2007 COX-2 suppresses tissue factor expression via endocannabinoid-directed PPARdelta activation.
17721619 2007 Identification of tissue factor and platelet-derived particles on leukocytes during cardiopulmonary bypass by flow cytometry and immunoelectron microscopy.
17675290 2007 Histone deacetylase inhibitors suppress TF-kappaB-dependent agonist-driven tissue factor expression in endothelial cells and monocytes.
17663729 2007 Redundant signaling of tissue factor and thrombin in cancer progression?
17598015 2007 Parallel decrease of tissue factor surface exposure and increase of tissue factor microparticle release by the n-3 fatty acid docosahexaenoate in endothelial cells.
17597988 2007 The changing faces of tissue factor biology. A personal tribute to the understanding of the "extrinsic coagulation activation".
17586694 2007 Plexiform-like lesions and increased tissue factor expression in a rat model of severe pulmonary arterial hypertension.
17577783 2007 Coordinated deregulation of cellular receptors, proangiogenic factors and intracellular pathways in acute myeloid leukaemia.
17549302 2007 Nuclear factor of activated T cells and early growth response-1 cooperate to mediate tissue factor gene induction by vascular endothelial growth factor in endothelial cells.
17536017 2007 Tissue factor: a link between C5a and neutrophil activation in antiphospholipid antibody induced fetal injury.
17483700 2007 High availability of intravascular tissue factor in neonates.
17470200 2007 Transcriptional program induced by factor VIIa-tissue factor, PAR1 and PAR2 in MDA-MB-231 cells.
17469850 2007 Lipid-bound factor Xa regulates tissue factor activity.
17469034 2007 Plasma tissue factor and tissue factor pathway inhibitor in patients with primary glomerulonephritis.
17459125 2007 Seminal factor VII and factor VIIa: supporting evidence for the presence of an active tissue factor-dependent coagulation pathway in human semen.
17401435 2007 1,25(OH)(2)D(3) blocks TNF-induced monocytic tissue factor expression by inhibition of transcription factors AP-1 and NF-kappaB.
17384202 2007 Tissue factor trafficking in fibroblasts: involvement of protease-activated receptor-mediated cell signaling.
17347408 2007 Human platelets synthesize and express functional tissue factor.
17334638 2007 Gender differences in the association of gene polymorphisms with type 2 diabetes mellitus.
17331567 2007 Tissue factor and urokinase-type plasminogen activator system are related to the presence of cardiovascular disease in hemodialysis patients.
17324918 Modulation of monocytic lipopolysaccharide-induced tissue factor expression and tumor necrosis factor alpha release by estrogen and calcitriol.
17323935 2007 Identification of a basic region on tissue factor that interacts with the first epidermal growth factor-like domain of factor X.
17314141 2007 Stimulation of P2 (P2X7) receptors in human dendritic cells induces the release of tissue factor-bearing microparticles.
17237436 2007 Serum amyloid A induces monocyte tissue factor.
17234207 2007 The development of cardiac fibrosis in low tissue factor mice is gender-dependent and is associated with differential regulation of urokinase plasminogen activator.
17200764 2007 Alternatively spliced human tissue factor (asHTF) is not pro-coagulant.
17200762 2007 Alternatively spliced tissue factor - one cut too many?
17200119 2007 The local phospholipid environment modulates the activation of blood clotting.
17196206 2007 Dyslipidemia shifts the tissue factor/tissue factor pathway inhibitor balance toward increased thrombogenicity in atherosclerotic plaques: evidence for a corrective effect of statins.
17157899 2007 The intersubject variability of tissue factor mRNA production in human monocytes--relation with the toll-like receptor 4.
17137581 2007 Differential functions of tissue factor in the trans-activation of cellular signalling pathways.
17066404 2007 Tissue factor expression is a clinical indicator of lymphatic metastasis and poor prognosis in gastric cancer with intestinal phenotype.
17060476 2006 Signal-dependent splicing of tissue factor pre-mRNA modulates the thrombogenicity of human platelets.
17008590 2006 Tissue factor and coagulation factor VII levels during acute myocardial infarction: association with genotype and adverse events.
16959886 2006 Disulfide isomerization switches tissue factor from coagulation to cell signaling.
16949034 2006 Differential effect of celecoxib on tissue factor expression in human endothelial and vascular smooth muscle cells.
16937466 2006 Expression of tissue factor in pancreatic adenocarcinoma is associated with activation of coagulation.
16930953 2006 Verotoxin-1 stimulation of macrophage-like THP-1 cells up-regulates tissue factor expression through activation of c-Yes tyrosine kinase: Possible signal transduction in tissue factor up-regulation.
16894464 2006 Formation of tissue factor-factor VIIa-factor Xa complex prevents apoptosis in human breast cancer cells.
16839353 2006 Traces of factor VIIa modulate thromboplastin sensitivity to factors V, VII, X, and prothrombin.
16835245 2006 Raising the active site of factor VIIa above the membrane surface reduces its procoagulant activity but not factor VII autoactivation.
16820938 2006 Assessment of genetic factors for type 2 diabetes mellitus.
16794185 2006 Paclitaxel enhances thrombin-induced endothelial tissue factor expression via c-Jun terminal NH2 kinase activation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16697385 2007 Induction of tissue factor expression and release as microparticles in ECV304 cell line by Chlamydia pneumoniae infection.
16634740 2006 Polymorphism in the tissue factor region is associated with basal but not endotoxin-induced tissue factor-mRNA levels in leukocytes.
16531802 2006 Tissue factor expression and activity are not increased in peripheral monocytes isolated from uncomplicated hypertensive patients.
16529959 Phospholipid surfaces regulate the delivery of substrate to tissue factor:VIIa and the removal of product.
16516912 2006 Cocaine unbalances endothelial tissue factor and tissue factor pathway inhibitor expression.
16510984 2005 Structure of human factor VIIa/tissue factor in complex with a peptide-mimetic inhibitor: high selectivity against thrombin by introducing two charged groups in P2 and P4.
16507316 2007 Suppression of human monocyte tissue factor induction by red wine phenolics and synthetic derivatives of resveratrol.
16493499 2006 Differential expression of tissue factor mRNA and protein expression in murine sepsis. The role of the granulocyte revisited.
16490369 Cancer-associated thrombosis.
16488980 2006 Protein S stimulates inhibition of the tissue factor pathway by tissue factor pathway inhibitor.
16473535 Initiation of coagulation by tissue factor carriers in blood.
16453151 2006 Tumour-expressed tissue factor inhibits cellular cytotoxicity.
16363246 2005 Differential gene expression in activated monocyte-derived macrophages following binding of factor VIIa to tissue factor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16324758 2006 Inter-relationships of indices of endothelial damage/dysfunction [circulating endothelial cells, von Willebrand factor and flow-mediated dilatation] to tissue factor and interleukin-6 in acute coronary syndromes.
16239598 2005 Genetic variations in the tissue factor gene are associated with clinical outcome in acute coronary syndrome and expression levels in human monocytes.
16236262 2005 Regulation of tissue factor and angiogenesis-related genes by changes in cell shape.
16217771 2006 Identification of a novel human tissue factor splice variant that is upregulated in tumor cells.
16215234 2005 The tissue factor requirement in blood coagulation.
16182846 Induction of tissue factor expression on human umbilical vein endothelial cells by cell-specific HLA class I antibody: preliminary data.
16113838 2005 Tissue factor is regulated by epidermal growth factor in normal and malignant human endometrial epithelial cells.
16113798 2005 A subpopulation of human B lymphocytes can express a functional Tissue Factor in response to phorbol myristate acetate.
16020745 2005 Endogenous NO blockade enhances tissue factor expression via increased Ca2+ influx through MCP-1 in endothelial cells by monocyte adhesion.
15996056 2005 Importance of C-reactive protein in regulating monocyte tissue factor expression in patients with inflammatory rheumatic diseases.
15935832 2005 Transforming growth factor beta-1 released from platelets contributes to hypercoagulability in veno-occlusive disease following hematopoetic stem cell transplantation.
15905465 2005 Signaling of the tissue factor coagulation pathway in angiogenesis and cancer.
15892865 2005 Genetic factors contribute to bleeding after cardiac surgery.
15869604 2005 Tissue factor enhances protease-activated receptor-2-mediated factor VIIa cell proliferative properties.
15865421 2005 Activity, folding, misfolding, and aggregation in vitro of the naturally occurring human tissue factor mutant R200W.
15860742 2005 Intracellular and surface distribution of monocyte tissue factor: application to intersubject variability.
15842359 2005 Shiga toxin enhances functional tissue factor on human glomerular endothelial cells: implications for the pathophysiology of hemolytic uremic syndrome.
15835921 2005 Large enhancement of functional activity of active site-inhibited factor VIIa due to protein dimerization: insights into mechanism of assembly/disassembly from tissue factor.
15814630 2005 Prognostic significance of tissue factor in pancreatic ductal adenocarcinoma.
15664864 2005 Design of selective phenylglycine amide tissue factor/factor VIIa inhibitors.
15630487 2005 Regulation of chemotaxis by the cytoplasmic domain of tissue factor.
15604222 2005 Tissue factor activity in whole blood.
15562024 2005 Progesterone increases tissue factor gene expression, procoagulant activity, and invasion in the breast cancer cell line ZR-75-1.
15522303 2004 Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
15494427 2005 Oncogenic events regulate tissue factor expression in colorectal cancer cells: implications for tumor progression and angiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467908 2004 Tissue factor and tissue factor pathway inhibitor levels in trophoblast cells: implications for placental hemostasis.
15328160 2005 Acute cholesterol depletion impairs functional expression of tissue factor in fibroblasts: modulation of tissue factor activity by membrane cholesterol.
15304041 2004 Polymorphisms in the 5'-UTR of the tissue factor gene are associated with altered expression in human endothelial cells.
15252050 2004 The cofactor function of the N-terminal domain of tissue factor.
15242552 2004 Rac regulates thrombin-induced tissue factor expression in pulmonary artery smooth muscle cells involving the nuclear factor-kappaB pathway.
15213854 2004 Tissue factor messenger RNA levels in leukocytes compared with tissue factor antigens in plasma from patients in hypercoagulable state caused by various diseases.
15213840 2004 The epidermal growth factor receptor (EGFR) and proline rich tyrosine kinase 2 (PYK2) are involved in tissue factor dependent factor VIIa signalling in HaCaT cells.
15182581 2004 [Study of the effect of TF/FVIIa complex on the expression of u-PAR mRNA in human ovarian cancer].
15161741 2004 Human pancreatic duct cells exert tissue factor-dependent procoagulant activity: relevance to islet transplantation.
15154603 2004 Platelet-derived microvesicles transfer tissue factor to monocytes but not to neutrophils.
15117736 2004 Role of tissue factor in hemostasis, thrombosis, and vascular development.
15041276 2003 Induction of tissue factor expression in human monocytic cells by protease inhibitors through activating activator protein-1 (AP-1) with phosphorylation of Jun-N-terminal kinase and p38.
15034796 2004 Tissue factor and fibrin in tumor angiogenesis.
15034795 2004 Oncogenes as regulators of tissue factor expression in cancer: implications for tumor angiogenesis and anti-cancer therapy.
15016732 2004 FVIIa:TF induces cell survival via G12/G13-dependent Jak/STAT activation and BclXL production.
14961150 2004 The TF-603A/G gene promoter polymorphism and circulating monocyte tissue factor gene expression in healthy volunteers.
14756558 2004 Similar molecular interactions of factor VII and factor VIIa with the tissue factor region that allosterically regulates enzyme activity.
14750502 2003 An all-atom solution-equilibrated model for human extrinsic blood coagulation complex (sTF-VIIa-Xa): a protein-protein docking and molecular dynamics refinement study.
14738565 2003 Human cell-derived microparticles promote thrombus formation in vivo in a tissue factor-dependent manner.
14678810 2003 Tissue factor expression in atrial endothelia associated with nonvalvular atrial fibrillation: possible involvement in intracardiac thrombogenesis.
14675093 2003 Superantigens from Staphylococcus aureus induce procoagulant activity and monocyte tissue factor expression in whole blood and mononuclear cells via IL-1 beta.
14675092 2003 Nicotinamide inhibits endotoxin-induced monocyte tissue factor expression.
14610342 2003 Tissue factor, its pathway inhibitor, and metabolic disturbances in long-term peritoneal dialysis.
14597990 2003 PML/RARalpha plays a role for basal activity and retinoid-induced repression of the tissue factor promoter in acute promyelocytic leukemia cells.
12941032 2003 Pro- and non-coagulant forms of non-cell-bound tissue factor in vivo.
12920028 2003 Regulation of tissue factor cytoplasmic domain phosphorylation by palmitoylation.
12903530 [Expression of tissue factor and vascular endothelial growth factor in colorectal carcinoma].
12883669 The expression of tissue factor correlates with proliferative ability in meningioma.
12871349 2003 Tissue factor: in at the start...and the finish?
12787023 2003 Probing the interface between factor Xa and tissue factor in the quaternary complex tissue factor-factor VIIa-factor Xa-tissue factor pathway inhibitor.
12654807 2003 M type 1 and 3 group A streptococci stimulate tissue factor-mediated procoagulant activity in human monocytes and endothelial cells.
12652293 2003 Alternatively spliced human tissue factor: a circulating, soluble, thrombogenic protein.
12603864 2003 Regulation of tissue factor in microvascular dermal endothelial cells.
12544727 2003 Ex-vivo regulation of endotoxin-induced tissue factor in whole blood by eicosanoids.
12540946 2003 Intravascular tissue factor pathway--a model for rapid initiation of coagulation within the blood vessel.
12529356 2003 Role of the Gla and first epidermal growth factor-like domains of factor X in the prothrombinase and tissue factor-factor VIIa complexes.
12514112 2003 Intravascular tissue factor initiates coagulation via circulating microvesicles and platelets.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426405 2002 Tissue factor deficiency causes cardiac fibrosis and left ventricular dysfunction.
12408769 2002 Relationship between tissue factor expression and hepatic metastasis and prognosis in rectal cancer.
12356487 2002 The inhibitors of the tissue factor:factor VII pathway.
12353085 2002 15-deoxy-delta12,14-Prostaglandin J2 inhibits tissue factor expression in human macrophages and endothelial cells: evidence for ERK1/2 signaling pathway blockade.
12270558 2002 Tissue factor (TF) and tissue factor pathway inhibitor (TFPI) in the placenta and myometrium.
12192302 2002 Platelet-CD40 ligand interaction with melanoma cell and monocyte CD40 enhances cellular procoagulant activity.
12189027 2002 The presence and release of tissue factor from human platelets.
12172458 2002 Tissue factor and angiogenesis in cancer.
12152682 2002 Model of a ternary complex between activated factor VII, tissue factor and factor IX.
12152652 2002 Adenosine inhibits tissue factor expression by LPS-stimulated human monocytes: involvement of the A3 adenosine receptor.
12149215 2002 Induction of permeability across endothelial cell monolayers by tumor necrosis factor (TNF) occurs via a tissue factor-dependent mechanism: relationship between the procoagulant and permeability effects of TNF.
12095134 2002 Monocyte adhesion and transmigration induce tissue factor expression: role of the mitogen-activated protein kinases.
12083501 2002 Tissue factor expression on monocyte subpopulations during normal pregnancy.
12083487 2002 Tissue factor activity is upregulated in human endothelial cells exposed to oscillatory shear stress.
12070020 2002 Thrombin functions during tissue factor-induced blood coagulation.
12036889 2002 Tissue factor is the receptor for plasminogen type 1 on 1-LN human prostate cancer cells.
12028585 2002 Differential expression of tissue factor and tissue factor pathway inhibitor in metastatic melanoma lesions.
12019261 2002 VIIa/tissue factor interaction results in a tissue factor cytoplasmic domain-independent activation of protein synthesis, p70, and p90 S6 kinase phosphorylation.
12008961 2002 Cholesterol-induced thrombogenicity of the vessel wall: inhibitory effect of fluvastatin.
11994566 2002 Enhanced monocyte tissue factor expression in hepatosplenic schistosomiasis.
11973337 2002 Factor VIIa induces tissue factor-dependent up-regulation of interleukin-8 in a human keratinocyte line.
11943929 2002 Hemoglobin binds melanoma cell tissue factor and enhances its procoagulant activity.
11921018 2002 Expression of tissue factor and vascular endothelial growth factor is associated with angiogenesis in colorectal cancer.
11858480 2002 The tissue factor and plasminogen activator inhibitor type-1 response in pediatric sepsis-induced multiple organ failure.
11858185 2002 Neurohormonal activation does not explain elevated tissue factor expression in heart failure.
11858183 2002 Mechanism of resveratrol-mediated suppression of tissue factor gene expression.
11816709 2001 Role of protease-activated receptor 1 in tumor metastasis promoted by tissue factor.
11816707 2001 Imbalance of plasminogen activator inhibitor-I/ tissue plasminogen activator and tissue factor/tissue factor pathway inhibitor in young Japanese men with myocardial infarction.
11776298 2001 The pleiotropic effects of tissue factor: a possible role for factor VIIa-induced intracellular signalling?
11601848 2001 The 1.85 A resolution crystal structures of tissue factor in complex with humanized Fab D3h44 and of free humanized Fab D3h44: revisiting the solvation of antigen combining sites.
11583305 2001 The TF:VIIa complex: clinical significance, structure-function relationships and its role in signaling and metastasis.
11307801 2001 Generation of a humanized, high affinity anti-tissue factor antibody for use as a novel antithrombotic therapeutic.
10896200 2000 Tissue factor and cancer procoagulant expressed by glioma cells participate in their thrombin-mediated proliferation.
10856975 1999 Tissue factor pathway.
9925787 1999 Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant.
9490735 1998 A role for tissue factor in cell adhesion and migration mediated by interaction with actin-binding protein 280.
9490681 1998 Tissue factor regulates plasminogen binding and activation.
9480775 1998 The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.G9 complex.
9414278 1998 Factor VII deficiency caused by a structural variant N57D of the first epidermal growth factor domain.
9192667 1997 Effect of tissue factor deficiency on mouse and tumor development.
8940045 1996 Factor VII central. A novel mutation in the catalytic domain that reduces tissue factor binding, impairs activation by factor Xa, and abolishes amidolytic and coagulant activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702971 1996 Substrate recognition by tissue factor-factor VIIa. Evidence for interaction of residues Lys165 and Lys166 of tissue factor with the 4-carboxyglutamate-rich domain of factor X.
8609606 1996 The crystal structure of the extracellular domain of human tissue factor refined to 1.7 A resolution.
8598903 1996 The crystal structure of the complex of blood coagulation factor VIIa with soluble tissue factor.
8086403 1994 Structure of the extracellular domain of human tissue factor: location of the factor VIIa binding site.
7615158 1995 Regulation of the tissue factor gene.
7598447 1995 Tissue factor pathway inhibitor and the revised theory of coagulation.
4023720 1985 Tissue factor gene localized to human chromosome 1 (1pter----1p21).
3527261 1986 Factor VII binding to tissue factor in reconstituted phospholipid vesicles: induction of cooperativity by phosphatidylserine.
3455766 1986 Affinity purification of human tissue factor: interaction of factor VII and tissue factor in detergent micelles.
3424286 1987 Cloning and expression of human tissue factor cDNA.
3399965 1988 Regional assignment of human tissue factor gene (F3) to chromosome 1p21-p22.
3297348 1987 Molecular cloning of the cDNA for tissue factor, the cellular receptor for the initiation of the coagulation protease cascade.
3166978 1988 Human tissue factor contains thioester-linked palmitate and stearate on the cytoplasmic half-cystine.
3037536 1987 Isolation of cDNA clones coding for human tissue factor: primary structure of the protein and cDNA.
2823875 1987 Human tissue factor: cDNA sequence and chromosome localization of the gene.
2719931 1989 Complete sequence of the human tissue factor gene, a highly regulated cellular receptor that initiates the coagulation protease cascade.
2719077 1989 Selective cellular expression of tissue factor in human tissues. Implications for disorders of hemostasis and thrombosis.
2704749 1989 Localization of tissue factor in the normal vessel wall and in the atherosclerotic plaque.
2315317 1990 Functional analysis of the human tissue factor promoter and induction by serum.
2271516 1990 Regulation of coagulation by a multivalent Kunitz-type inhibitor.
1740409 1992 The cytoplasmic domain of tissue factor is phosphorylated by a protein kinase C-dependent mechanism.
392457 1979 [Initiation in vivo of blood coagulation. The role of white blood cells and tissue factor (author's transl)].