Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.45198782162913E-5
diabetes mellitus 1663 0.00135796834579844
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 0.001
group 4 medulloblastoma 2.600 0.000

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALS      1 - 70
PRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS                       71 - 122
//

Text Mined References (2)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.