Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 4 medulloblastoma 1855 1.5e-05
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.4e-03
group 4 medulloblastoma 2.600 1.5e-05

AA Sequence

MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALS      1 - 70
PRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTALYLVEEAWAEAGKMRS                       71 - 122
//

Text Mined References (2)

PMID Year Title