Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.400 4.1e-03
lung adenocarcinoma 1.300 4.1e-05
pituitary cancer 1.400 1.3e-05
posterior fossa group B ependymoma -1.300 2.4e-07

Synonym

Accession F2Z333
Symbols C1orf233

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRAPPLLLLLAACAPPPCAAAAPTPPGWEPTPDAPWCPYKVLPEGPEAGGGRLCFRSPARGFRCQAPGCV      1 - 70
LHAPAGRSLRASVLRNRSVLLQWRLAPAAARRVRAFALNCSWRGAYTRFPCERVLLGASCRDYLLPDVHD     71 - 140
SVLYRLCLQPLPLRAGPAAAAPETPEPAECVEFTAEPAGMQDIVVAMTAVGGSICVMLVVICLLVAYITE    141 - 210
NLMRPALARPGLRRHP                                                          211 - 226
//

Text Mined References (3)

PMID Year Title