Property Summary

Ligand Count 3
NCBI Gene PubMed Count 84
PubMed Score 34.12
PubTator Score 103.13

Knowledge Summary

Patent (31,178)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.2e-20

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.400 1.2e-20

 CSPA Cell Line (1)

Gene RIF (68)

AA Sequence

MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRAL      1 - 70
LLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQ     71 - 140
RWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALP    141 - 210
LTLQRQTFRLARSDRVLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGH    211 - 280
ALRLTAVVLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDK    281 - 350
VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ                                       351 - 385
//

Text Mined References (84)

PMID Year Title