Property Summary

Ligand Count 265
NCBI Gene PubMed Count 349
PubMed Score 550.96
PubTator Score 701.28

Knowledge Summary

Patent (77,288)

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.200 3.9e-02
adult high grade glioma 3.200 9.8e-08
astrocytic glioma 2.400 4.0e-03
Astrocytoma, Pilocytic 2.700 9.9e-09
atypical teratoid / rhabdoid tumor 4.200 1.5e-10
ependymoma 2.000 3.4e-02
esophageal adenocarcinoma 1.200 2.6e-02
gastric cancer 1.400 1.0e-02
glioblastoma 3.500 2.2e-13
group 3 medulloblastoma 2.400 2.9e-04
head and neck cancer -1.200 4.3e-02
interstitial cystitis 1.400 1.6e-05
medulloblastoma, large-cell 3.000 1.1e-07
nasopharyngeal carcinoma 1.100 2.8e-05
oligodendroglioma 1.900 9.7e-03
osteosarcoma 1.242 4.8e-05
ovarian cancer 1.300 2.9e-03
primary pancreatic ductal adenocarcinoma 1.170 2.2e-02
primary Sjogren syndrome 1.100 5.4e-04
primitive neuroectodermal tumor 3.900 3.7e-07
ulcerative colitis 2.600 1.6e-07

PDB (10)

Gene RIF (303)

AA Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR      1 - 70
LVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY     71 - 140
MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS    141 - 210
LSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF    211 - 280
VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY    281 - 350
FAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY    351 - 420
KKLLT                                                                     421 - 425
//

Text Mined References (351)

PMID Year Title