Property Summary

NCBI Gene PubMed Count 339
PubMed Score 534.62
PubTator Score 701.28

Knowledge Summary

Patent (77,288)

Expression

  Differential Expression (21)

Disease log2 FC p
gastric carcinoma 2.300 5.2e-03
astrocytoma 2.600 4.7e-27
posterior fossa group A ependymoma 3.800 2.5e-19
oligodendroglioma 2.400 1.2e-16
esophageal adenocarcinoma 1.200 2.6e-02
glioblastoma 4.500 7.6e-09
osteosarcoma 1.384 3.5e-04
sonic hedgehog group medulloblastoma 3.700 1.0e-09
atypical teratoid / rhabdoid tumor 4.200 1.5e-10
medulloblastoma, large-cell 3.000 1.1e-07
primitive neuroectodermal tumor 3.900 3.7e-07
primary pancreatic ductal adenocarcinoma 1.170 2.2e-02
interstitial cystitis 1.400 1.6e-05
pediatric high grade glioma 4.100 7.8e-11
pilocytic astrocytoma 2.800 7.5e-09
primary Sjogren syndrome 1.100 5.4e-04
nasopharyngeal carcinoma 1.100 2.8e-05
acute myeloid leukemia -1.200 3.9e-02
ulcerative colitis 2.600 1.6e-07
ovarian cancer 1.300 2.9e-03
head and neck cancer -1.200 4.3e-02

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652255 confirmatory 1 / 0 / 1 Discovery of Novel Antagonists of Protease activated receptor 4: PAR 1 Selectivity CRC Assay

Gene RIF (295)

PMID Text
27023670 These results suggest that stabilization of microtubule-unbound tau by phosphorylation at Ser262/356 via the PAR-1/MARK may act in the initial steps of tau mismetabolism in AD pathogenesis
26875892 The serum levels of PAR1 might have a diagnostic value in lung cancer patients
26729042 Thrombin and the PAR-1 activating peptide, TFLLR, lead to the phosphorylation of eNOS-Ser-1177 in human coronary artery endothelial cells, which was blocked by SCH-79797 (SCH), a PAR-1 inhibitor.
26681756 PZ-128 is a promising antiplatelet agent that provides rapid, specific, dose dependent, and reversible inhibition of platelet protease-activated receptor-1 through a novel intracellular mechanism.
26635365 Rab11A and Rab11B differentially regulate intracellular trafficking of PAR1 through distinct endosomal sorting mechanisms
26600192 Binding of the PH domain of PAR-1 enables breast cancer growth and extravillous trophoblast invasion.
26475502 thrombin/PAR-1 interaction regulated MCP-1, TF, MCSF and IL-6 production.
26424552 conjugation of a peptide fragment derived from the third intracellular loop (i3) of the protease-activated receptor 1 (PAR1) to a peptide that can selectively target tumours
26283733 The data reveal a new proprotein convertases -PAR-1-interaction pathway, which offsets the effects of HIV-induced neuroinflammation, viral infection, and potentially the development of HIV-Associated Neurocognitive Disorder.
26283733 F2R (PAR1) DOES NOT block processing of Vpr by soluble PCSK6 (PACE4)
26283733 HIV-1 infectivity is decreased by F2R (PAR1), but not F2R (PAR1) mutant R46A, overexpression in the virus producing cells (HEK293T)
26278396 we show that the rs2227744A allele signi fi cantly associates with protection from sarcoidosis (P = 0.003, OR = 0.68 (0.52-0.88)
26244666 Results suggest that expression levels of protease activated receptors 1 and 2 (PAR-1 and PAR-2) associate with breast cancer outcome in an estrogen receptor (ER)-dependent manner.
26165842 identified HMGA2 (high mobility group A2) as an important regulator of PAR1-mediated invasion. Inhibition of PAR1 signaling suppresses HMGA2-driven invasion in breast cancer cells
26120939 Establish FXa as a potentially important asthma mediator, stimulating airway smooth muscle function through actions requiring PAR-1 and annexin A2 and involving integrin coactivation.
26100877 Data show that N-linked glycosylation of protease-activated receptor-1 (PAR1) at extracellular loop 2 (ECL2) controls G12/13 versus Gq G-proteins coupling specificity in response to thrombin stimulation.
26092994 Proteases found in dust derived from animal feed play an important role in eliciting the dust-mediated inflammatory responses at least partially through activation of PAR1 AND PAR2.
26020638 Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammation
25934391 The i3 pepducin enhances PAR1/Galpha subunit interactions and induces a conformational change in fluorescently labeled PAR1 in a very similar manner to that induced by thrombin.
25846512 Platelet activation with a PAR1 agonist triggered TGF-beta secretion, which induced EMT of via the downregulation of miR-200b expression, and activated platelets had a chemotactic effect on colon cancer cells mediated by the upregulation of CXCR4
25496845 low levels impact placenta establishment and consequently pregnancy outcome
25495701 PAR1-platelet releasate enhances vasculogenesis more potently than PAR4-platelet releasate, and the enhancements require a cooperation of multiple platelet-derived angiogenic regulators.
25294586 Apixaban exerts anti-inflammatory effects in mesangial cells by blocking thrombin/protease-activated receptor-1 system.
25119598 High protease-activated receptor-1 expression is associated with colorectal cancer.
24973402 data do not support a role for the rs2227744G>A F2R polymorphism in the development of COPD but suggest a protective role for this polymorphism from frequent exacerbations
24842054 Protease activated receptor-1 deficiency diminishes bleomycin-induced skin fibrosis
24830314 Human PAR1, expressed at low levels in mouse platelets, is unresponsive to agonist peptides.
24805876 The upregulation of MMP-1 protein combined with the overexpression of PAR-1 protein may contribute to the malignant progression of prostate cancer.
24776597 provide evidence against the hypothesis that PAR-1 and PAR-4 stimulation of platelets trigger differential release of alpha-granules
24740120 Data indicate that proteinase-activated receptor 1 (PAR1) was prominently expressed in hematopoietic stem cells.
24717606 It regulates vasoconstriction of pulmoanry arteries.(review)
24637088 PAR1 is the most abundant member of the PAR family present in all subtypes of lymphocytes, with the exception of B cells that do not express any PAR.
24624928 Oxidative stress and inflammatory reactions in endothelial cells follow up-regulation of PAR-1.
24620969 Tissue vascularization was found to be significantly increased in the compact tumor mass of glioblastomas compared to their invasion zone and specific overexpression of PAR-1 within tumor cells and within tumor blood vessels depending upon the tumor area.
24612435 analysis of a P2Y12 receptor mutation and a function-reducing polymorphism in protease-activated receptor 1 in a patient with chronic bleeding [case report]
24435325 Suggest association of thrombin generation potential with platelet PAR-1 regulation and P-selectin expression in patients on dual antiplatelet therapy.
24405508 PAR-1 is post-transcriptionally regulated by miR-20b microRNA in human melanoma cells. PAR-1 was found to be expressed in metastatic melanoma cells but was barely detectable in primary melanoma.
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
24177339 our observations show that PAR1 and PAR2 act as a functional unit in tumor development and placenta-uterus interactions. This conclusion may have significant consequences on future breast cancer therapeutic modalities and improved late pregnancy outcome.
24009311 Findings suggest a novel pathway in which ERalpha signaling regulates miR-190a expression, causing inhibition of PAR-1 expression, correlated with inhibition of cancer metastasis in breast cancer.
23921961 Data indicate that knockdowns of all three PARs PAR-1, PAR-2, and PAR-3 exhibited changes in the expression of CDC42, which correlated with the changes in their invasion.
23919450 interaction with thrombin and alveolar epithelial cells might directly contribute to the pathogenesis of pulmonary fibrosis through epithelial-mesenchymal transition via PAR-1
23814055 Noncanonical MMP-1-PAR1 signaling resulted in the opposite effect and led to a dedifferentiated phenotype via a different G protein pathway. MMP-1-PAR1 significantly stimulated hyperplasia and migration of SMCs.
23739922 Protease-activated receptors (PAR)-1 and -3 drive epithelial-mesenchymal transition of alveolar epithelial cells - potential role in lung fibrosis.
23625915 inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1.
23580642 palmitoylation of PAR1 regulates appropriate utilization of tyrosine-based motifs by adaptor proteins and endocytic trafficking, processes that are critical for maintaining appropriate expression of PAR1 at the cell surface.
23548249 The PAR-1 -14 Ivs A/A genotype was associated with advanced tumor stages and with shorter median survival in squamous cell lung carcinoma.
23517743 Results suggest that the AA genotype of the PAR-1 variation IVSn -14 A>T is associated with an increased risk of metastasis and poorer prognosis of renal cell carcinoma
23512987 Data indicate that STIM1 plays its role within the thrombin signaling independently of store-operated Ca2+ entry (SOCE) through Orai channels as a signaling component linking the thrombin receptor to RhoA activation and stress fiber formation.
23476015 Upon thrombin activation, PAR1-PAR2 dimers co-internalize and recruit beta-arrestins to endosomes.
23436459 Active proteases in nephrotic plasma lead to a podocin-dependent phosphorylation of VASP in podocytes via protease activated receptor-1.
23421536 Data indicate that thrombin-induced IL-1ss and IL-6 cytokine release in naive PBMCs is PAR-1-dependent.
23406164 A PI3K-dependent thrombin generation and the resultant PAR-1 activation serve as an indispensable mechanism to relay the platelet activation process induced by ADP
23395513 Plaque vulnerability correlated negatively with KLF2 but positively with PAR-1. Upregulation of KLF2 and downregulation of PAR-1 could be direct or indirect effects of statin therapy.
23307185 Stimulation of PAR-1 in platelets results in less thrombin generation compared to PAR-4 stimulation.
23293110 VEGFR-2 and PAR-1 polymorphisms predicted longer disease-free survival and overall survival in pancreatic carcinoma. CXCR-2 polymorphism was a negative predictor for disease-free survival.
23280079 Thrombin mediates an excess in the production of neoangiogenetic (VEGF) and profibrotic (PAI-1) factors in human peritoneal mesothelial cells.
23242308 These results demonstrate that PAR1 activation induces cell morphological change associated with cell motility via Rho family activation and cytoskeletal protein overexpression, and has a critical role in gastric cancer cell invasion and metastasis.
23222541 2.2 A resolution crystal structure of human PAR1 bound to vorapaxar, a PAR1 antagonist
23204166 We found that peripheral blood effector memory CD4(+) and CD8(+) T lymphocytes expressed PAR-1 and that expression was increased in CD8(+) T cells from HIV-infected patients via thrombin activation.
23155052 MMP-1 promotes VEGFR2 expression and proliferation of endothelial cells through stimulation of PAR-1 and activation of NF-kappaB
23113835 The data of this study suggested an important role for PAR1 function in NMDAR-dependent processes subserving memory formation and synaptic plasticity.
23065128 TF inhibition caused basal cell apoptosis and necrosis. This was due to two parallel but interdependent TF-regulated processes: failure to generate a basal cell-associated fibrin network and suboptimal PAR1 and PAR2 activity.
22993310 study found PAR-1 IVSn-14 T allele is a risk factor for H. pylori-related gastric cancer in ethnic Chinese subjects; PAR-1 -506 ins/del polymorphism is not involved in gastric carcinogenesis
22952817 GrB released from T cells induced neurotoxicity by interacting with the membrane bound Gi-coupled PAR-1 receptor and subsequently activated Kv1.3 and Notch-1
22952809 PAR signaling and serine protease-induced alterations in endothelial function modulate glomerular inflammation via parallel but independent pathways
22833563 Data indicate that AP-3 facilitates PAR1 interaction with ALIX.
22685255 Thrombin receptor positivity in vascular endothelial cells may be an adverse prognostic factor for patients with esophageal squamous cell carcinoma and increased coagulation state.
22659187 protease-activated receptor 1 possesses a functional and cleavable signal peptide which is necessary for receptor expression
22610965 demonstrate that beta-adrenergic receptor stimulation leads to MMP-13 transactivation of protease-activated receptor 1 in both cardiac fibroblasts and cardiomyocytes
22593082 PAR1 expression and signal transduction are modulated by progesterone; this provides new insight into how the progestin component in hormone therapies increases the risk of breast cancer in postmenopausal women.
22573325 Silencing of PAR1 suppressed invasive stellate growth of lung cancer cells in three-dimensional matrices.
22562397 PAR-1 may contribute to the growth and invasive potential of nasopharyngeal carcinoma cells
22552271 Our results suggest the possibility that the integrated effect of functionally-related EGFR and PAR-1 genes (haplotype cluster) is associated with susceptibility to airway hyperresponsiveness.
22541814 Genetic inhibition of PAR-1 receptors reveals that they are involved in thrombin-mediated upregulation of heme oxygenase-1.
22291441 estrogen regulation of hPar1 in breast cancer was demonstrated by an endothelial tube-forming network
22283974 Our results also show that platelet PAI-1 is increased if incubated for 24 hours, both with addition of PAR1-activating peptide and without activation, which could indicate de novo synthesis.
22278285 PAR-1-dependent and PAR-independent signaling involves the rapid phosphorylation of ERK, which in turn is absolutely required for thrombin-induced CCL2 secretion at both low and standard concentration of the proteinase
22212092 PHBs are localized on the human platelet membrane and are involved in PAR1-mediated platelet aggregation.
22106258 These findings identify a role for beta-arrestin and Dvl-2 scaffolds in APC-activated PAR1 cytoprotective signaling in human endothelial cells.
22009534 PAR-1 plays a key role in melanoma progression. PAR-1 & its activating factors on tumor cells & the surrounding stroma induce coagulation & cell signaling promotoing the metastatic phenotype. Review.
21993564 PAR(1) and PAR(2) are involved in WM9 cell proliferation and secretion of IL-8 by activation of PKD1.
21966428 Galectin-3 facilitates cell motility in gastric cancer by up-regulating protease-activated receptor-1 (PAR-1) and matrix metalloproteinase-1 (MMP-1).
21965661 AP-2 and epsin-1 are both required to promote efficient internalization of activated PAR1 and recognize discrete receptor sorting signals
21909684 High proteinase-activated receptor-1 is associated with hepatocellular carcinoma.
21905006 Activation of PAR-1 stimulates MMP-2 secretion, inhibits rheumatoid arthritis synovial fibroblasts growth and invasion, and decreases production of IL-17 and TNFalpha by them.
21835828 A subset of gallbladder carcinoma cases showed overexpression of protease-activated receptor-1 (PAR-1), which was associated with progressive pathology and an aggressive clinical course.
21822552 Our study suggested the protective effect of the allele D at -506 locus of PAR1 gene on the recurrence of breast cancer.
21760880 extracellular Granzyme K is capable of activating PAR-1 and inducing fibroblast cytokine secretion and proliferation
21753781 KLK6-induced intracellular Ca(2+) flux and tumor cell invasion critically depends on the protease-activated receptor 1 (PAR1).
21673343 Blocking platelet TLR2 and TLR4 with mAbs reduced the percentage of activated platelets and lowered the amount of thrombin generated in platelet-rich plasma.
21649850 PKC inhibition markedly enhances Ca2+ signaling and phosphatidylserine exposure downstream of protease-activated receptor-1 but not protease-activated receptor-4 in human platelets.
21605334 Statins prevent tissue factor induction by PAR-agonist peptides altering the membrane localization of PAR1 and the expression of PAR2.
21591259 These findings implicate MMP-1 as an important activator of PAR1 in sepsis and suggest that therapeutics that target MMP1-PAR1 may prove beneficial in the treatment of sepsis.
21586224 Peritumoral PAR1 mRNA expression was significantly increased in hepatocellular carcinoma from the patients with tumor recurrence as compared with those without recurrence.
21550978 N-linked glycosylation regulates human proteinase-activated receptor-1 cell surface expression and disarming via neutrophil proteinases and thermolysin
21536369 Replacement of the flexible autolysis loop of human thrombin with the homologous rigid domain of the murine enzyme results in a drastic (up to 10-fold) increase in Na(+) affinity and a significant improvement in the catalytic activity of the enzyme.
21375587 study did not show a significant association of PAR 1 -506 ID polymorphism and venous thromboembolism in cancer
21252088 FVIIa, upon binding to EPCR on endothelial cells, activates endogenous protease activated receptor-1 (PAR1) and induces PAR1-mediated p44/42 mitogen-activated protein kinase (MAPK) activation.
21216163 a significant increase in PAR-1 expression in granulocytes from CML patients in blast phase (CML-BP) but not in chronic phase (CML-CP) as compared to healthy donors
21209875 Activation of urothelial PAR1 receptors, either by locally generated thrombin or proteases present in the urine, may mediate bladder inflammation by inducing urothelial MIF release and upregulating urothelial MIF expression
21187389 PAR-1 negatively regulates the expression of the Maspin tumor-suppressor gene in the acquisition of the metastatic melanoma phenotype
21149441 EPCR interacts with the ternary TF coagulation initiation complex to enable PAR1,2 signaling.
21127289 Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2alpha differently for cyclooxygenase-1 and 12-lipoxygenase catalysis.
21037076 TF-PAR-1 pathway contributes to liver fibrosis induced by chronic cholestasis by increasing expression of the alphaVbeta6 integrin, an important regulator of transforming growth factor-beta1 activation.
20945373 VASP deficiency leads to a more profound endothelial barrier disruption and delayed recovery after activation of thrombin PAR-1 receptor.
20826780 Factor X/Xa elicits protective signaling responses in endothelial cells directly via PAR-2 and indirectly via endothelial protein C receptor-dependent recruitment of PAR-1.
20819545 In cerebellum, thrombin can activate PAR-1 expression after ICH, and PN-1 appears quickly after Intracerebral hemorrhage in order to control the deleterious effect of thrombin.
20807173 Results suggest that lower levels of protease-activated receptors 1 and 4 contribute to the poor thrombin induced aggregation observed with newborn platelets, which can not be compensated by higher levels of GPIbalpha.
20723226 Activation of Proteinase-Activated Receptor-1 mediates gastric cancer cell proliferation and invasion.
20697725 protease activity and gene expression are increased in acne lesions
20691446 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585578 results support the hypothesis that the interaction between these two functionally related genes may influence the risk of MI and suggest new mechanisms involved in the genetic susceptibility to MI
20585578 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20571025 Thrombin stimulation of proteoglycan synthesis in vascular smooth muscle is mediated by protease-activated receptor-1 transactivation of the transforming growth factor beta type I receptor.
20559570 by preventing binding of Etk/Bmx to PAR(1) -C-tail, hPar1 oncogenic properties are abrogated
20506163 Data show that occupancy of EPCR by protein C switches signaling specificity so that activation of PAR-1 by thrombin inhibits TNF-alpha-mediated synthesis of IL-6 and IL-8 and down-regulates TGF-beta-mediated expression of collagen type 4 and fibronectin.
20482314 The results indicate differential signaling pathways mediated by TK in promoting prostate cancer cell migration and invasion via PAR(1) activation, and proliferation via kinin B2 receptor stimulation.
20442298 PAR3-deficient cells in contrast to PAR1-deficient cells form larger tumors in immunodeficient mice.
20404340 analysis of thrombin engineered for selective specificity toward protein C and PAR1
20388375 PAR-1 may play an important role in the metastasis of lung giant cell carcinoma cells by up-regulating intracellular calcium.
20368337 N-linked glycosylation of PAR1 at the N terminus versus the surface of ECL2 serves distinct functions critical for proper regulation of receptor trafficking and the fidelity of thrombin signaling
20237496 Observational study of gene-disease association. (HuGE Navigator)
20236938 present the 1.8 A resolution structure of thrombin S195A in complex with a 30-residue long uncleaved extracellular fragment of PAR1 that documents for the first time a productive binding mode bridging the active site and exosite I
20230207 Data show that PAR1 and PAR4-activating peptides were as effective as thrombin in inducing annexin V binding in combination with collagen-related peptide in diluted whole blood and platelet rich plasma, but not in washed platelets.
20175118 Thrombin enhances the migration of chondrosarcoma cells by increasing MMP-2 and MMP-13 expression through the PAR/PLC/PKCalpha/c-Src/NF-kappaB signal transduction pathway.
20164183 protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization
20155436 Human cytomegalovirus induces PARs expression through transcriptional activation in endothelial cells, increasing sensitivity to thrombin.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20101173 Observational study of gene-disease association. (HuGE Navigator)
20084489 Our results provide strong evidence supporting the implication of PAR-1 in the malignant progression of human melanoma.
20056842 KLK4 signaling via PAR1 may represent a novel pathway in colon tumorigenesis.
19969492 The [-1426(C/T)] polymorphic variant of PAR1 is associated with thrombocytopenia in Gaucher disease.
19969492 Observational study of gene-disease association. (HuGE Navigator)
19929245 Data show that heparin and lepirudin inhibit thrombin-inducible cleavage and internalization of PAR-1 and platelet activation in vitro to a similar extent.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19907018 PAR1-regulated ATP release from 1321N1 astrocytoma cells is remarkably sensitive to both positive and negative modulation by extracellular osmolarity.
19895674 Endothelial protein C receptor plays an unexpected role in supporting cell surface recruitment, PAR1 activation, and signaling by FXa.
19879874 The study demonstrates a novel role of TK in skin wound healing uncovering new signaling pathway mediated by TK in promoting keratinocyte migration through activation of the PAR(1)-PKC-Src-MMP pathway and HB-EGF/AR shedding-dependent EGFR transactivation.
19858310 Human PAR1 and PAR2 have a redundant role in the activation of human cells by Candida albicans.
19795418 Prostate cancer cells exhibit a novel double-paracrine mechanism whereby cancer epithelium produces KLK4 to activate PAR-1 in the surrounding stroma, in-turn releasing cytokines that stimulate cancer cells to proliferate & increase production of KLKs.
19764478 It plays a povital role in the interaction between blood coagulation system and vascular wall. (review)
19703903 analysis of the cross-talk between protease-activated receptor 1 and platelet-activating factor receptor regulates melanoma cell adhesion molecule (MCAM/MUC18) expression and melanoma metastasis
19694963 Results demonstrate that PAR(1) and PAR(2) but not PAR(4) mediate contraction in human oesophageal muscularis mucosae. PAR(1) and PAR(2) may influence human oesophageal motility.
19690217 This study establishes a crucial role of zyxin in thrombin signaling in endothelial cells and provides evidence for a novel PAR-1 signaling pathway mediated by zyxin.
19679555 Overexpression of protease-activated receptor-1 contributes to melanoma metastasis via regulation of connexin 43.
19622587 Polymorphisms in PAR-1, ES, and IL-8 may serve as independent molecular prognostic markers in patients with localized gastric adenocarcinoma
19622587 Observational study of gene-disease association. (HuGE Navigator)
19608609 Selective cleavage of PAR-1 on oral epithelial cells by Porphyromonas gingivalis Rgp gingipain therefore upregulates expression of pro-inflammatory cytokines.
19567485 activation by thrombin induces CXCL5 expression in gingival epithelial cells
19538737 PAR1 is selectively overexpressed in high grade breast cancer patients: a cohort study is reported.
19460777 NFAT2 contributes to the transcriptional control of PAR-1 in vascular smooth muscle cells
19424642 Evidence for increased expression of tissue factor and protease-activated receptor-1 in human esophageal cancer.
19404549 Variants in the coagulation factor 2 receptor (F2R) gene influence the risk of myocardial infarction in men through an interaction with interleukin 6 serum levels.
19404549 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19379698 Study shows that platelet MMP-1 activates protease-activated receptor-1 (PAR1) on the surface of platelets; exposure of platelets to fibrillar collagen converts the surface-bound proMMP-1 zymogen to active MMP-1, which promotes aggregation through PAR1.
19332793 Activated protein C selective signaling and endothelial barrier protective effects are mediated through compartmentalization of PAR(1) in caveolae and a novel mechanism of PAR(1) signal regulation
19307610 leukocyte elastase-induced apoptosis of lung epithelial cells is mediated by a PAR-1-triggered pathway involving activation of NF-kappaB and p53, and a PUMA- and Bax-dependent increase in mitochondrial permeability leading to activation of distal caspases
19162217 SPHK1 inhibition is a novel way to block PAR-1 mediated signalling.
19080851 No association was found between 2 F2R/PAR1 polymorphisms and Crohn disease or ulcerative colitis.
19064940 PAR-1 regulates eNOS activity via phosphorylation of eNOS-Thr495, which is dependent upon activation of the Rho/ROCK pathway.
19064814 PAR1 and PAR2 regulate endothelial NO synthase phosphorylation and activity through G(12/13) and G(q), respectively, delineating the signaling pathways by which the proteases act on protease-activated receptors to modulate endothelial functions.
19053259 For the first time, the complete protease-activated receptor 4 utilizes the anionic cluster to interact with alpha-thrombin on cells; this interaction is also important in the presence of protease activated receptor 1.
19040205 Consequences of modulation of PAR1 and PAR2 expression and function on cytotrophoblast invasion and beta-catenin stabilization, were examined.
18988801 Results demonstrate that via PAR-1, MMP-1 activates mitogen-activated protein kinase signaling cascades in microvessel endothelial cells, and may complement the activity of thrombin to better facilitate angiogenesis and promote tumor progression.
18983479 identify ROS originating in mitochondria as key mediators of the signaling pathways triggered by PAR1 and PAR2 engagement in endothelial cells; mechanisms downstream from PAR1 and PAR2 activation, different for the two receptors, also induced TF
18974842 Observational study of gene-disease association. (HuGE Navigator)
18832729 protease-mediated epithelial PAR-1 and -2 activation, by migrating PMNs, induces signaling events that increase epithelial permeability thereby facilitates PMN transepithelial migration.
18820708 p53 directly affects hPar1 expression and function, thus providing evidence for direct binding between p53 and hPar1 chromatin.
18687805 Thrombin receptor and RhoA mediate cell proliferation through integrins and cysteine-rich protein 61.
18682394 Coordinate activation of human platelet protease-activated receptor-1 and -4 in response to subnanomolar alpha-thrombin
18657231 PAR-1 activation induces IL-8 synthesis by late endothelial progenitor cells (EPC). This could potentially enhance cooperation between late and early EPCs during neovascularization, through a paracrine
18612544 Protease activated receptor 1 (PAR-1) activation by thrombin is protective in human pulmonary artery endothelial cells if endothelial protein C receptor is occupied by its natural ligand, protein C.
18570113 Placentas from pregnancies complicated by preterm PE had a significantly higher frequency of strong PAR-1(protease-activated receptor 1) expression than placentas from women with spontaneous preterm labor.
18537828 PGE(2)-induced reduction of PAR-1 level is not due to a decrease of PAR-1 mRNA stability, but rather to transcriptional regulation.
18386288 The expression and function of PAR-1 in benign prostatic hyperplasia stroma indicate PAR-1 may play important roles in BPH pathogenesis
18384756 Plasmin activates PAR-1 and is involved in inflammation in human dental pulp.
18372913 PAR1-stimulated EGFR and ErbB2 transactivation leads to prolonged extracellular signal-regulated kinase-1 and -2 signaling and promotes breast carcinoma cell invasion.
18363813 Protease activated receptor 1 activation of platelet is associated with an increase in protein kinase CK2 activity
18314110 Report the production of vascular endothelial growth factor and MMP-1/2 via protease-activated receptor in human endometrial stromal cells.
18308730 These data provide insight into KLK4-mediated cell signaling and suggest that signals induced by this enzyme via protease-activated receptors may be important in prostate cancer.
18284602 Lipid raft localization regulates the cleavage specificity of protease activated receptor 1 in endothelial cells
18278202 Failed to validate association of PAR-1 gene polymorphisms with venous thromboembolism amoung Californians of European ancestry.
18179608 similar to the guinea-pig gallbladder, both PAR(1) and PAR(2) but not PAR(4) mediate muscle contraction in the human gallbladder
18174463 it is proposed that annexin 2 acts as a receptor for factor Xa on the surface of human umbilical vein endothelial cells and that annexin 2 facilitates factor Xa activation of PAR-1 but does not enhance coagulant function of factor Xa
18089851 The data suggest that different trafficking of activated PAR1 might explain how PAR1 signaling by APC can be relevant when thrombin is present.
18064407 genetically unstable molecule; thousands of types of mutation can be expected
18005014 Findings suggest that PAR-1 receptor polymorphisms in chronic hepatitis C influence the progression of liver fibrosis.
18005014 Observational study of gene-disease association. (HuGE Navigator)
17935246 Observational study of gene-disease association. (HuGE Navigator)
17935246 Protease activated receptor 1 gene polymorphism is associated with preterm deliveries
17895623 Hypothesis that statins increase risk of hemorrhagic stroke by inhibiting PAR1 receptor is plausible but requires further direct testing in randomized trials.
17883592 Platelet PAR-1/PAR-4 stimulation causes rapid Akt phosphorylation downstream of PLC, whereas with continuous stimulation, ADP and PI3K are required for maintaining Akt phosphorylation.
17848177 PAR1 localization in the caveolin-enriched membrane microdomain, bound to caveolin-1, represents a crucial requirement for TF induction in endothelial cells.
17823308 when EPCR is bound by protein C, the PAR-1 cleavage-dependent protective signaling responses in endothelial cells can be mediated by either thrombin or APC.
17721620 Platelet stimulation with thrombin induces a time- and concentration-dependent regulation of the microtubular content
17706138 PAR-1 may enhance metastasis of lung cancer through its regulation of cellular proliferation, adhesion and invasion.
17675516 P. gingivalis, therefore, selectively up-regulated CCR5 by two independent signaling pathways, Rgp acting on PAR-1 and PAR-2, and LPS on TLR2 and TLR4.
17623652 trypsin IV and p23 are inhibitor-resistant trypsins that can cleave and activate PARs, causing PAR(1)- and PAR(2)-dependent inflammation and PAR(2)-dependent hyperalgesia.
17492768 Activation of PAR1-induced dynamic cytoskeletal reorganization and reduced PC-3 binding to collagen I, collagen IV, and laminin (P < 0.01) but not fibronectin.
17470200 factor VIIa-tissue factor, PAR1 and PAR2 have roles in transcription in tumor cell lines
17414212 REVIEW: the signaling and regulatory mechanisms of protease-activated receptors in various tissues
17384202 roles of PAR1 and PAR2 and F7 in tissue factor mobilization and endocytosis
17376866 PAR3 has a role in allosterically regulating PAR1 signaling governing increased endothelial permeability
17374729 These results altogether identify PAR1 as a survival factor that protects cells from undergoing apoptosis.
17373694 PARs (PAR-1, PAR-2, and PAR-4) are overexpressed in prostate cancer and may serve as potential predictors of recurrence. The data suggest potential role of PARs in autocrine and paracrine mechanisms of prostate cancer.
17347481 Observational study of gene-disease association. (HuGE Navigator)
17323377 cooperative PAR(1)/PAR(4) signaling network that contributes to thrombin-mediated tumor cell migration in hepatocellular carcinoma
17303701 This study has identified an important role for the direct activation of G(i/o) by PAR1 in human platelets
17294805 The antiproliferative effect was more pronounced in cell cultures displaying higher expression of PAR1.
17267663 These data revealed that PAR1 can be part of a preassembled complex with Galpha(i1) protein, resulting either from a direct interaction between these partners or from their colocalization in specific microdomains.
17015787 PAR-1 agonism causes platelet activation, venous constriction, arterial dilatation, and tPA release in vivo in humans.
16952995 new class of cell-penetrating inhibitors, termed pepducins, that provide insight into previously unidentified roles of PAR1 and PAR4 in protease signaling.
16946713 Loss of AP-2 is a crucial event in the progression of human melanoma and contributes to the acquisition of the metastatic phenotype via upregulation of PAR-1.
16839349 the role of thrombin in myocardial damage after coronary artery bypass grafting
16837456 Data show that at relatively high concentration of agonist, inhibition of the P2Y12 receptor and of calcium mobilization result in complete inhibition of PAR4-induced aggregation, with no effect on either thrombin or PAR1-mediated platelet aggregation.
16803467 PAR-1 activation did not modify the number of colonies or the day of emergence, in keeping with the lack of induction of angiopoietin 1 gene expression; PAR-1 activation also enhanced migration toward angiopoietin 1
16709572 protease-activated receptor-1 has a role in calcium influx, which activates a feed-forward mechanism of TRPC1 expression via nuclear factor-kappaB activation in endothelial cells
16606835 Because LTD4 and thrombin are likely to be formed concomitantly in vivo, cysLT2-R and PAR-1 may cooperate to augment vascular injury.
16409451 Significant thrombin generation can occur on vascular tissue in the absence of platelets or platelet microparticles and on the surface of non-apoptotic SMC.
16407403 These findings establish an essential role for endogenous SNX1 in sorting activated PAR1 to a distinct lysosomal degradative pathway that is independent of retromer, Hrs, and Tsg101.
16359518 PAR1 and also PAR2 can mediate barrier protection in endothelial cells and FXa can use either receptor to enhance barrier integrity
16354660 the transmembrane 7-8th helix-i1 loop may move in a coordinated manner to transfer the signal from PAR1 to G protein.
16354200 A blocking antibody to PAR-1 abolishes activated protein C effects on keratinocytes.
16341594 Data show that membrane transport of p42(IP4) induced by epidermal growth factor is inhibited by stimulation of phospholipase C-coupled thrombin receptor.
16194864 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16141404 PAR-1 activation promotes cell proliferation and CXCR4-dependent migration and differentiation, leading to a proangiogenic effect
16087677 Plasmin and thrombin accelerate shedding of syndecan-4 ectodomain, which generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds
16052512 Data show that stimulation of PAR1 results in increased DNA binding of the NFkappaB p65 subunit, and that activation of PAR1 attenuates docetaxel induced apoptosis through the upregulation of Bcl-xL.
16021575 a role for PAR-1 in the initial phases of melanoma development as well as in tumor progression and metastasis
15923186 mapped for the first time the epitopes of thrombin recognizing a macromolecular ligand, hirudin, in the S and F forms
15891109 leukocyte elastase mediates apoptosis of human lung epithelial cells through PAR-1-dependent modulation of the intrinsic apoptotic pathway via alterations in mitochondrial permeability and by modulation of JNK and Akt
15878870 analysis of protease-activated receptor-1 selectivity for G protein signaling by agonist peptides and thrombin
15869604 FVIIa induces PRIM1 and ensuing cellular proliferation via a TF- and of the PARs entirely PAR-2-dependent pathway, in distinction to that of thrombin which is PAR-1-dependent and TF-independent
15860737 Rac1 plays a critical role in maintaining the surface expression of PAR1 and the responsiveness to thrombin in vascular smooth muscle cells
15821019 May stimulate PGE2 in pulmonary fibrosis by airway epithelium
15769747 by signaling through the same receptor PAR1, APC, and thrombin can exert distinct biological effects in perturbed endothelium
15755869 findings imply that the thrombin/protease-activated receptor 1 system system might be involved in the pathophysiology of endometriosis, stimulating inflammatory responses of endometriotic cells and their mitogenic activity
15707890 MMP-1 in the stromal-tumor microenvironment can alter the behavior of cancer cells through PAR1 to promote cell migration and invasion.
15626732 cross-communication between the prototypical barrier-protective S1P and barrier-disruptive PAR1 pathway
15625067 Low levels of protease-activated receptor-1 expression is associated with lymph node metastasis in squamous cell carcinoma of the head and neck
15582715 PAR3 receptors and analogues can mediate cell signaling by interaction with PAR1-type thrombin receptors
15563688 PGE(2) downregulated expression of all three PARs in pulmonary fibrosis
15561975 cause activation of a Ca(2+)-independent PLA(2)in bladder microvascular endothelial cells
15559761 PAR1 seems to be the responsible receptor for thrombin-induced migration and adhesion of human colon carcinoma cells including PKCepsilon as an essential signal transducer
15550696 In vitro factor Xa stimulated interleukin-8 and monocyte chemoattractant protein-1 release and RNA expression by activation of protease-activated receptor 1.
15548541 the crystal structure of thrombin bound to heparin shows that the asymmetric unit is composed of two thrombin dimers, each sharing a single heparin octasaccharide chain
15522964 thrombin via PAR1 induced the internalization of endoglin and type-II TGF-beta receptor (TbetaRII) but not type-I receptors in human ECs
15455382 Overexpression of protease activated receptor 1 is associated with ovarian carcinoma
15383630 PAR1 activation induced a matrix metalloproteinase-dependent release of transforming growth factor-alpha (TGF-alpha), activation of epidermal growth factor receptor (EGFR)and extracellular signal-regulated protein kinase 1/2 (ERK1/2).
15313016 Sustained stimulation of platelet TR is associated with tyrosine dephosphorylation of a novel p67 peptide in a manner regulated by extracellular calcium
15280447 data confirm a role for PAR1 in migration and metastasis and demonstrate an unexpected role for PAR2 in thrombin-dependent tumor cell migration and in metastasis
15247268 role in chemotaxis in conjuction with plasmin
15191806 PAR1 is most intensely expressed in astrocytes of white and gray matter and moderately expressed in neurons. PAR1 and GFAP co-localization demonstrates that PAR1 is expressed on the cell body and on astrocytic endfeet that invest capillaries.
15183114 The inactivation of PAR1 due to proteolytic removal of the ligand region may contribute to the termination of the intracellular signaling initiated by thrombin in the vascular endothelial cells.
15099288 results suggest stimulation of both the PAR1 & PAR4 receptors are necessary for thrombin-induced procoagulant activity, & the P2Y(12) receptor, but not the P2Y(1) receptor, is responsible for potentiation of agonist-induced platelet procoagulant activity
15078882 PAR-1 and PAR-4 signal Rap1B activation, the ability of thrombin to activate this GTPase independently of secreted ADP involves costimulation of both receptors as well as binding to GPIb-IX-V.
15045135 evidence that only one of the thrombin platelet receptors, PAR1 or PAR4, is sufficient to induce intracellular signaling leading to the cleavage of the beta3 cytoplasmic domain
15023990 internalization of activated PAR1 is controlled by multiple regulatory mechanisms involving phosphorylation and a highly conserved tyrosine-based motif, YXXL
14982936 the information that specifies PAR1 shedding resides within its N-terminal exodomain rather than its heptahelical segment; and ADAM17/TACE or a metalloproteinase with similar properties mediates PAR1 shedding
14966279 Results reveal that a novel alteration in trafficking of activated protease-activated receptor 1 causes persistent signaling, and may contribute to breast carcinoma cell invasion.
14961162 stroke patients exhibited significant cleavage and internalization of PAR-1 and failed to respond to thrombin in vitro, indicating that high concentrations of thrombin occur with acute cerebrovascular ischemic events in vivo
14642534 thrombin disarms PAR-1 from further proteolytic activation, but leaves the receptor responsive for non-tethered ligands
14632180 PAR-1 mRNA was expressed specifically in the mesenchymal portions, including dermal papilla and connective tissue sheath, of anagen hair follicles.
14623891 PAR-1 signaling, along with thrombin, has a role in up-regulating the synthesis of TFPI-2 via a MAPK/COX-2-dependent pathway
14521606 PAR-1 and PAR-4 have roles in activating GPIb translocation into the cytoskeleton in platelets
14507634 PAR1 is the predominant thrombin receptor on invasive extravillous trophoblasts;findings support a role for PAR1, and potentially PAR2 and PAR3 in the invasive phase of human placentation
13680213 Our data suggest that thrombin/PAR-1 may inhibit Sp1-dependent HCMV replication, which might be an important regulatory mechanism for HCMV persistence and replication in RPE
12975361 analysis of the PAR-1 promoter regions bp -365 to -329 and bp -206 to -180 demonstrated that Sp1 was predominantly bound to the PAR-1 promoter in metastatic cells, whereas AP-2 was bound to the PAR-1 promoter in nonmetastatic cells.
12883880 PAR-1 mediates the proliferation-modulating effects of thrombin on prostate cancer cells.
12832443 PAR1 could be clearly detected on the surface of eosinophils, however thrombin had no effect on eosinophil function
12805069 differentiation of human monocytes is associated with differential expression of functionally active PARs that mediate distinct regulatory functions in inflammation and atherogenesis.
12789289 This review focuses on the role of the thrombin receptor in melanoma and its regulation by AP-2.
12737439 gastric epithelial cells express thrombin receptors and that these receptors may play a protective role in the gastric mucosa.
12707033 the aberrant expression of the functional thrombin receptor PAR-1 in colon cancers and its important involvement in cell proliferation and motility
12637343 Review. PAR1 expression correlates with the invasion properties of breast carcinoma. Part of the molecular mechanism of PAR1 invasion involves the formation of focal contact complexes on PAR1 activation.
12594292 Activation and up-regulation of PAR1 is tightly coupled to brain inflammation and neuronal damage during HIV-1 infection.
12586611 data suggest that activated protein C regulates calcium concentration in human brain endothelium and in human umbilical vein endothelial cells by binding to endothelial protein C receptor and signaling via protease activated receptor-1
12534282 PAR1 is a primary mediator of RhoA activation, signaling, and cytoskeletal reorganization when expressed on LNCaP prostate cancer cells.
12505789 Thrombin upregulates COX-2-derived prostaglandin E2 synthesis by both catalytic cleavage of PAR1 and bFGF-dependent noncatalytic activity
12406873 The number of PAR-1 receptors on the platelet surface is associated with the intervening sequence IVSn-14 A/T intronic variation, and it was also found to govern the platelet response to the SFLLRN agonist in terms of aggregation & P-selectin expression.
12372769 stimulation of PAR-1 or PAR-2 on HUR leads to iPLA(2)-catalyzed phospholipid hydrolysis, resulting in the production of metabolites that may mediate inflammation or provide cytoprotection to the bladder.
12370395 PAR1-mediated proinflammatory cytokine release from respiratory epithelial cells in vitro is inhibited by pretreatment with house dust mite allergen Der p 1.
12195707 Both PAR1 and PAR2 upregulate COX-2, but not COX-1, expression in HUVEC cells
12084570 These data suggest that an untranslated RNA plays a role in PAR-1 gene expression during embryonic growth.
12058063 down-regulation is controlled by sorting nexin 1
12052963 target for endothelial cell protein C receptor (EPCR)-dependent activated protein C(APC) signaling, suggesting a role for this receptor cascade in protection from sepsis
12039967 a novel role for Go proteins in the signal transduction of thrombin receptors in HMECs (human microvascular endothelial cells) that regulates calcium signaling
12023853 Role of thrombin and its major cellular receptor, protease-activated receptor-1, in pulmonary fibrosis. Review.
11986954 CLL B cells consistently express thrombin receptor mRNA; co-expression of angiogenic molecules and receptors suggest autocrine pathways of stimulation.
11964083 PAR-1 is upregulated in pancreatic cancer
11907122 When expressed in respiratory epithelial cells and cell lines, protease-activated receptor 1 (PAR1)induces the release of IL-6, IL-8, and PGE2.
11888681 Proteolytic activation of PAR1 is required for thrombin stimulation and the control of angiogenic processes in tissue repair.
11816709 Though PAR1 is insufficient to induce metastasis in cells with low TF expression, it enhances the metastatic potential of cells with high TF expression, indicating a possible synergy between TF and PAR1 in promoting metastasis.

AA Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYR      1 - 70
LVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVY     71 - 140
MLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQS    141 - 210
LSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFF    211 - 280
VPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAY    281 - 350
FAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY    351 - 420
KKLLT                                                                     421 - 425
//

Text Mined References (341)

PMID Year Title
27023670 2016 Stabilization of Microtubule-Unbound Tau via Tau Phosphorylation at Ser262/356 by Par-1/MARK Contributes to Augmentation of AD-Related Phosphorylation and A?42-Induced Tau Toxicity.
26875892 2016 Clinical significance of serum protease activated receptor1 levels in patients with lung cancer.
26729042 2016 Featured Article: Differential regulation of endothelial nitric oxide synthase phosphorylation by protease-activated receptors in adult human endothelial cells.
26681756 2016 Cell-Penetrating Pepducin Therapy Targeting PAR1 in Subjects With Coronary Artery Disease.
26635365 2016 Recycling and Endosomal Sorting of Protease-activated Receptor-1 Is Distinctly Regulated by Rab11A and Rab11B Proteins.
26600192 2015 PH motifs in PAR1&2 endow breast cancer growth.
26475502 2016 Thrombin induced by the extrinsic pathway and PAR-1 regulated inflammation at the site of fracture repair.
26424552 2015 Down-regulation of PAR1 activity with a pHLIP-based allosteric antagonist induces cancer cell death.
26283733 2015 Neuroinflammation-Induced Interactions between Protease-Activated Receptor 1 and Proprotein Convertases in HIV-Associated Neurocognitive Disorder.
26278396 2015 Role of a functional polymorphism in the F2R gene promoter in sarcoidosis.
26244666 2015 Protease Activated Receptors 1 and 2 Correlate Differently with Breast Cancer Aggressiveness Depending on Tumor ER Status.
26238780 2015 Colon Cancer Growth and Dissemination Relies upon Thrombin, Stromal PAR-1, and Fibrinogen.
26170698 2015 Expression of MMP-1/PAR-1 and patterns of invasion in oral squamous cell carcinoma as potential prognostic markers.
26165842 2016 Dysregulated protease activated receptor 1 (PAR1) promotes metastatic phenotype in breast cancer through HMGA2.
26149041 2015 Antiplatelet drugs: which targets for which treatments?
26120939 2016 The Coagulant Factor Xa Induces Protease-Activated Receptor-1 and Annexin A2-Dependent Airway Smooth Muscle Cytokine Production and Cell Proliferation.
26100877 2015 N-linked glycosylation of protease-activated receptor-1 at extracellular loop 2 regulates G-protein signaling bias.
26092994 2015 Proteases in agricultural dust induce lung inflammation through PAR-1 and PAR-2 activation.
26084674 2015 Activated protein C ?-glycoform promotes enhanced noncanonical PAR1 proteolysis and superior resistance to ischemic injury.
26083907 2015 Specific activation, signalling and secretion profiles of human platelets following PAR-1 and PAR-4 stimulation.
26082997 2015 Stimulation of PAR-1 or PAR-4 promotes similar pattern of VEGF and endostatin release and pro-angiogenic responses mediated by human platelets.
26068939 2015 Octahydrocyclopenta[c]pyridine and octahydrocyclopenta[c]pyran analogues as a protease activated receptor 1 (PAR1) antagonist.
26037286 2015 Risk and benefit of direct oral anticoagulants or PAR-1 antagonists in addition to antiplatelet therapy in patients with acute coronary syndrome.
26020638 2015 Macrophage Migration Inhibitory Factor Mediates PAR-Induced Bladder Pain.
25986685 2015 From Multiple PAR1 Receptor/Protein Interactions to their Multiple Therapeutic Implications.
25934391 2015 Allosteric Activation of a G Protein-coupled Receptor with Cell-penetrating Receptor Mimetics.
25846512 2015 Activation of platelet protease-activated receptor-1 induces epithelial-mesenchymal transition and chemotaxis of colon cancer cell line SW620.
25689283 2015 Protease-activated receptor (PAR)-2 is required for PAR-1 signalling in pulmonary fibrosis.
25589770 2015 PAR1-activated astrocytes in the nucleus of the solitary tract stimulate adjacent neurons via NMDA receptors.
25552512 [Peptide-agonist of protease-activated receptor (PAR 1), similar to activated protein C, promotes proliferation in keratinocytes and wound healing of epithelial layer].
25496845 2015 Protease-activated-receptor 1 polymorphisms correlate with risk for unexplained recurrent pregnancy loss: a pilot study querying an association beyond coagulation.
25495701 2015 PAR1-stimulated platelet releasate promotes angiogenic activities of endothelial progenitor cells more potently than PAR4-stimulated platelet releasate.
25297082 2014 Protease-activated receptor (PAR)1, PAR2 and PAR4 expressions in esophageal squamous cell carcinoma.
25294586 2014 Apixaban exerts anti-inflammatory effects in mesangial cells by blocking thrombin/protease-activated receptor-1 system.
25119598 2014 Downregulation of a long noncoding RNA-ncRuPAR contributes to tumor inhibition in colorectal cancer.
25007158 2015 Screening of phytochemicals against protease activated receptor 1 (PAR1), a promising target for cancer.
24973402 2014 Impact of a functional polymorphism in the PAR-1 gene promoter in COPD and COPD exacerbations.
24842054 2014 Protease activated receptor-1 deficiency diminishes bleomycin-induced skin fibrosis.
24830314 2014 Platelet specific promoters are insufficient to express protease activated receptor 1 (PAR1) transgene in mouse platelets.
24805876 2014 Prognostic value of matrix metalloprotease-1/protease-activated receptor-1 axis in patients with prostate cancer.
24776597 2014 Quantitative proteomics analysis reveals similar release profiles following specific PAR-1 or PAR-4 stimulation of platelets.
24740120 2014 Proteinase-Activated Receptor 1 (PAR1) regulates leukemic stem cell functions.
24732013 2014 Prohibitin is involved in the activated internalization and degradation of protease-activated receptor 1.
24717606 2014 [Potential of proteinase-activated receptors as a novel target for treatment of pulmonary hypertension].
24637088 Expression pattern of protease activated receptors in lymphoid cells.
24624928 2014 Advanced glycation end products potentiate citrated plasma-evoked oxidative and inflammatory reactions in endothelial cells by up-regulating protease-activated receptor-1 expression.
24620969 2014 Overexpression of protease-activated receptor type 1 (PAR-1) in glioblastoma multiforme WHO IV cells and blood vessels revealed by NCAM-assisted glioblastoma border labeling.
24612435 2014 A novel mutation in the P2Y12 receptor and a function-reducing polymorphism in protease-activated receptor 1 in a patient with chronic bleeding.
24435325 2014 Association of thrombin generation potential with platelet PAR-1 regulation and P-selectin expression in patients on dual antiplatelet therapy.
24405508 2014 miR-20b regulates expression of proteinase-activated receptor-1 (PAR-1) thrombin receptor in melanoma cells.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
24177339 2014 Protease-activated-receptor-2 affects protease-activated-receptor-1-driven breast cancer.
24009311 2014 A novel estrogen receptor-microRNA 190a-PAR-1-pathway regulates breast cancer progression, a finding initially suggested by genome-wide analysis of loci associated with lymph-node metastasis.
23921961 2014 Proteinase-activated receptors differentially modulate in vitro invasion of human pancreatic adenocarcinoma PANC-1 cells in correlation with changes in the expression of CDC42 protein.
23919450 2013 Thrombin induces epithelial-mesenchymal transition via PAR-1, PKC, and ERK1/2 pathways in A549 cells.
23814055 2013 Noncanonical matrix metalloprotease-1-protease-activated receptor-1 signaling triggers vascular smooth muscle cell dedifferentiation and arterial stenosis.
23739922 2013 Protease-activated receptors (PAR)-1 and -3 drive epithelial-mesenchymal transition of alveolar epithelial cells - potential role in lung fibrosis.
23625915 2013 Store-operated Ca2+ entry (SOCE) induced by protease-activated receptor-1 mediates STIM1 protein phosphorylation to inhibit SOCE in endothelial cells through AMP-activated protein kinase and p38? mitogen-activated protein kinase.
23580642 2013 Palmitoylation of protease-activated receptor-1 regulates adaptor protein complex-2 and -3 interaction with tyrosine-based motifs and endocytic sorting.
23548249 2013 C-X-C motif receptor 2, endostatin and proteinase-activated receptor 1 polymorphisms as prognostic factors in NSCLC.
23517743 2013 The protease activated receptor 1 gene variation IVSn -14 A>T is associated with distant metastasis and cancer specific survival in renal cell carcinoma.
23512987 2013 STIMulating stress fibers in endothelial cells.
23476015 2013 Transactivation of the PAR1-PAR2 heterodimer by thrombin elicits ?-arrestin-mediated endosomal signaling.
23436459 2013 Active proteases in nephrotic plasma lead to a podocin-dependent phosphorylation of VASP in podocytes via protease activated receptor-1.
23421536 2013 Stimulation of naïve monocytes and PBMCs with coagulation proteases results in thrombin-mediated and PAR-1-dependent cytokine release and cell proliferation in PBMCs only.
23406164 2013 A critical role of thrombin/PAR-1 in ADP-induced platelet secretion and the second wave of aggregation.
23395513 2013 Role of Krüppel-like factor 2 and protease-activated receptor-1 in vulnerable plaques of ApoE(-/-) mice and intervention with statin.
23307185 2013 Protease-activated receptor (PAR) 1 and PAR4 differentially regulate factor V expression from human platelets.
23293110 2013 VEGFR-2, CXCR-2 and PAR-1 germline polymorphisms as predictors of survival in pancreatic carcinoma.
23280079 2013 PAR-1 mediates the thrombin-induced mesothelial cell overproduction of VEGF and PAI-1.
23242308 2013 The activation of proteinase-activated receptor-1 (PAR1) promotes gastric cancer cell alteration of cellular morphology related to cell motility and invasion.
23222541 2012 High-resolution crystal structure of human protease-activated receptor 1.
23204166 2013 Enhanced effector function of CD8(+) T cells from healthy controls and HIV-infected patients occurs through thrombin activation of protease-activated receptor 1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23155052 2013 Matrix metalloproteinase-1-mediated up-regulation of vascular endothelial growth factor-2 in endothelial cells.
23113835 2013 Protease-activated receptor-1 modulates hippocampal memory formation and synaptic plasticity.
23065128 2013 Tissue factor signals airway epithelial basal cell survival via coagulation and protease-activated receptor isoforms 1 and 2.
22993310 2012 PAR-1 polymorphisms and risk of Helicobacter pylori-related gastric cancer in a Chinese population.
22952817 2012 Granzyme B-induced neurotoxicity is mediated via activation of PAR-1 receptor and Kv1.3 channel.
22952809 2012 PR3 and elastase alter PAR1 signaling and trigger vWF release via a calcium-independent mechanism from glomerular endothelial cells.
22833563 2012 AP-3 regulates PAR1 ubiquitin-independent MVB/lysosomal sorting via an ALIX-mediated pathway.
22685255 2012 Effect of thrombin receptor expression on microvessel endothelial cells, and survival by coagulation state in oesophageal squamous cell carcinoma.
22659187 2012 The protease-activated receptor 1 possesses a functional and cleavable signal peptide which is necessary for receptor expression.
22610965 2012 ?-adrenergic receptor stimulation transactivates protease-activated receptor 1 via matrix metalloproteinase 13 in cardiac cells.
22593082 2012 Progesterone promotes focal adhesion formation and migration in breast cancer cells through induction of protease-activated receptor-1.
22573325 2012 Matrix metalloprotease-1a promotes tumorigenesis and metastasis.
22562397 2012 The activation of protease-activated receptor 1 mediates proliferation and invasion of nasopharyngeal carcinoma cells.
22552271 2012 Integrated effect of EGFR and PAR-1 signaling crosstalk on airway hyperresponsiveness.
22547407 2012 ALIX binds a YPX(3)L motif of the GPCR PAR1 and mediates ubiquitin-independent ESCRT-III/MVB sorting.
22541814 2012 Thrombin induces heme oxygenase-1 expression in human synovial fibroblasts through protease-activated receptor signaling pathways.
22291441 2012 Regulation of human protease-activated receptor 1 (hPar1) gene expression in breast cancer by estrogen.
22283974 2012 The role of thrombin receptors PAR1 and PAR4 for PAI-1 storage, synthesis and secretion by human platelets.
22278285 2012 PAR-1-dependent and PAR-independent pro-inflammatory signaling in human lung fibroblasts exposed to thrombin.
22212092 2012 Prohibitins are involved in protease-activated receptor 1-mediated platelet aggregation.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22106258 2011 Activated protein C promotes protease-activated receptor-1 cytoprotective signaling through ?-arrestin and dishevelled-2 scaffolds.
22009534 2011 PAR-1 and thrombin: the ties that bind the microenvironment to melanoma metastasis.
21993564 2012 Proteinase-activated receptors 1 and 2 regulate invasive behavior of human melanoma cells via activation of protein kinase D1.
21966428 2011 Galectin-3 facilitates cell motility in gastric cancer by up-regulating protease-activated receptor-1 (PAR-1) and matrix metalloproteinase-1 (MMP-1).
21965661 2011 Adaptor protein complex-2 (AP-2) and epsin-1 mediate protease-activated receptor-1 internalization via phosphorylation- and ubiquitination-dependent sorting signals.
21909684 2012 Prognostic value of matrix metalloproteinase-1/ proteinase-activated receptor-1 signaling axis in hepatocellular carcinoma.
21905006 2012 Protease-activated receptor 2, rather than protease-activated receptor 1, contributes to the aggressive properties of synovial fibroblasts in rheumatoid arthritis.
21835828 2011 Correlation between MMP1-PAR1 axis and clinical outcome of primary gallbladder carcinoma.
21822552 2012 The association of protease activated receptor 1 gene -506 I/D polymorphism with disease-free survival in breast cancer patients.
21760880 2011 Granzyme K activates protease-activated receptor-1.
21753781 2011 Expression and function of the kallikrein-related peptidase 6 in the human melanoma microenvironment.
21673343 2011 Extracellular histones promote thrombin generation through platelet-dependent mechanisms: involvement of platelet TLR2 and TLR4.
21649850 2011 PKC inhibition markedly enhances Ca2+ signaling and phosphatidylserine exposure downstream of protease-activated receptor-1 but not protease-activated receptor-4 in human platelets.
21605334 2011 Statins prevent tissue factor induction by protease-activated receptors 1 and 2 in human umbilical vein endothelial cells in vitro.
21591259 2011 A matrix metalloprotease-PAR1 system regulates vascular integrity, systemic inflammation and death in sepsis.
21586224 2011 [High expression of thrombin receptor PAR1 in peritumoral liver tissue is associated with poor survival after curative resection of hepatocellular carcinoma in early stage].
21550978 2011 N-linked glycosylation regulates human proteinase-activated receptor-1 cell surface expression and disarming via neutrophil proteinases and thermolysin.
21536369 2011 Rigidification of the autolysis loop enhances Na(+) binding to thrombin.
21375587 2011 Protease activated receptor 1 gene -506 I?/?D polymorphism in cancer patients with and without venous thrombosis.
21252088 2011 Factor VIIa bound to endothelial cell protein C receptor activates protease activated receptor-1 and mediates cell signaling and barrier protection.
21216163 2011 Increased expression of protease-activated receptor 1 (PAR-1) in human leukemias.
21209875 2010 Thrombin induces macrophage migration inhibitory factor release and upregulation in urothelium: a possible contribution to bladder inflammation.
21187389 2011 Protease activated receptor-1 inhibits the Maspin tumor-suppressor gene to determine the melanoma metastatic phenotype.
21149441 2011 The endothelial protein C receptor supports tissue factor ternary coagulation initiation complex signaling through protease-activated receptors.
21127289 2011 Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2? differently for cyclooxygenase-1 and 12-lipoxygenase catalysis.
21037076 2010 The coagulation system contributes to alphaVbeta6 integrin expression and liver fibrosis induced by cholestasis.
20945373 2011 Vasodilator-stimulated phosphoprotein deficiency potentiates PAR-1-induced increase in endothelial permeability in mouse lungs.
20826780 2010 Factor X/Xa elicits protective signaling responses in endothelial cells directly via PAR-2 and indirectly via endothelial protein C receptor-dependent recruitment of PAR-1.
20819545 2010 Expression of thrombin and its associated protein in cerebellum of human and rat after intracerebral hemorrhage.
20807173 2010 Newborn platelets: lower levels of protease-activated receptors cause hypoaggregability to thrombin.
20723226 2010 The activation of Proteinase-Activated Receptor-1 (PAR1) mediates gastric cancer cell proliferation and invasion.
20697725 2010 Protease-activated receptor-2 mediates the expression of inflammatory cytokines, antimicrobial peptides, and matrix metalloproteinases in keratinocytes in response to Propionibacterium acnes.
20691446 2010 Platelet gene polymorphisms and risk of bleeding in patients undergoing elective coronary angiography: a genetic substudy of the PRAGUE-8 trial.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20585578 2010 The interaction between coagulation factor 2 receptor and interleukin 6 haplotypes increases the risk of myocardial infarction in men.
20571025 2010 Thrombin stimulation of proteoglycan synthesis in vascular smooth muscle is mediated by protease-activated receptor-1 transactivation of the transforming growth factor beta type I receptor.
20559570 2010 Etk/Bmx regulates proteinase-activated-receptor1 (PAR1) in breast cancer invasion: signaling partners, hierarchy and physiological significance.
20506163 2010 Thrombin down-regulates the TGF-beta-mediated synthesis of collagen and fibronectin by human proximal tubule epithelial cells through the EPCR-dependent activation of PAR-1.
20482314 2010 Tissue kallikrein promotes prostate cancer cell migration and invasion via a protease-activated receptor-1-dependent signaling pathway.
20442298 2010 Thrombin regulates the metastatic potential of human rhabdomyosarcoma cells: distinct role of PAR1 and PAR3 signaling.
20404340 2010 Engineering thrombin for selective specificity toward protein C and PAR1.
20388375 2010 [PAR-1 regulation of intracellular Ca²(+) mobilization in pulmonary giant cell carcinoma cell line PLA801D/PLA801C].
20368337 2010 N-linked glycosylation of protease-activated receptor-1 second extracellular loop: a critical determinant for ligand-induced receptor activation and internalization.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20236938 2010 Crystal structure of thrombin bound to the uncleaved extracellular fragment of PAR1.
20230207 2010 Annexin V binding to platelets is agonist, time and temperature dependent.
20175118 2010 Thrombin enhanced migration and MMPs expression of human chondrosarcoma cells involves PAR receptor signaling pathway.
20164183 2010 A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
20155436 2010 Human cytomegalovirus increases HUVEC sensitivity to thrombin and modulates expression of thrombin receptors.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20101173 2010 Genetic variations in angiogenesis pathway genes predict tumor recurrence in localized adenocarcinoma of the esophagus.
20084489 2010 Protease-activated receptor-1 (PAR-1) promotes the motility of human melanomas and is associated to their metastatic phenotype.
20056842 2010 Kallikrein-related peptidase 4: a new activator of the aberrantly expressed protease-activated receptor 1 in colon cancer cells.
19969492 Proteinase-activated receptor (PAR1) polymorphic variant correlates with thrombocytopenia in Gaucher disease.
19929245 2009 Thrombin-inducible platelet adhesion and regulation of the platelet seven-transmembrane thrombin receptor-1 (PAR-1): effects of unfractionated heparin and lepirudin.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19907018 2010 Extracellular osmolarity modulates G protein-coupled receptor-dependent ATP release from 1321N1 astrocytoma cells.
19895674 2010 Coagulation factor Xa cleaves protease-activated receptor-1 and mediates signaling dependent on binding to the endothelial protein C receptor.
19879874 2010 A novel signaling pathway of tissue kallikrein in promoting keratinocyte migration: activation of proteinase-activated receptor 1 and epidermal growth factor receptor.
19858310 2010 Candida albicans releases soluble factors that potentiate cytokine production by human cells through a protease-activated receptor 1- and 2-independent pathway.
19795418 2010 Kallikrein-related peptidase-4 initiates tumor-stroma interactions in prostate cancer through protease-activated receptor-1.
19764478 2009 [Role of thrombin receptors in vascular physiology and pathophysiology].
19703903 2009 Crosstalk between protease-activated receptor 1 and platelet-activating factor receptor regulates melanoma cell adhesion molecule (MCAM/MUC18) expression and melanoma metastasis.
19694963 2010 Proteinase-activated receptors 1 and 2 mediate contraction of human oesophageal muscularis mucosae.
19690217 2009 Zyxin is involved in thrombin signaling via interaction with PAR-1 receptor.
19679555 2009 Overexpression of protease-activated receptor-1 contributes to melanoma metastasis via regulation of connexin 43.
19622587 2010 Genetic variations in angiogenesis pathway genes associated with clinical outcome in localized gastric adenocarcinoma.
19608609 2009 Cleavage of protease-activated receptors on an immortalized oral epithelial cell line by Porphyromonas gingivalis gingipains.
19567485 2010 Modulation of expression of innate immunity markers CXCL5/ENA-78 and CCL20/MIP3alpha by protease-activated receptors (PARs) in human gingival epithelial cells.
19538737 2009 PAR1 is selectively over expressed in high grade breast cancer patients: a cohort study.
19460777 2009 Regulation of protease-activated receptor-1 by vasodilatory prostaglandins via NFAT.
19424642 2009 Evidence for increased expression of tissue factor and protease-activated receptor-1 in human esophageal cancer.
19404549 2009 Variants in the coagulation factor 2 receptor (F2R) gene influence the risk of myocardial infarction in men through an interaction with interleukin 6 serum levels.
19379698 2009 Platelet matrix metalloprotease-1 mediates thrombogenesis by activating PAR1 at a cryptic ligand site.
19332793 2009 Caveolae are required for protease-selective signaling by protease-activated receptor-1.
19307610 2009 Leukocyte elastase induces lung epithelial apoptosis via a PAR-1-, NF-kappaB-, and p53-dependent pathway.
19162217 2009 Sphingosine kinase 1 is essential for proteinase-activated receptor-1 signalling in epithelial and endothelial cells.
19080851 2008 [Influence of mutations of proteinase-activated receptors F2R/PAR1 and F2RL1/PAR2 on inflammatory bowel disease].
19064940 2009 Role of protease-activated receptor-1 in endothelial nitric oxide synthase-Thr495 phosphorylation.
19064814 2009 Distinct roles of protease-activated receptors in signal transduction regulation of endothelial nitric oxide synthase.
19053259 2008 Protease-activated receptor 4 uses anionic residues to interact with alpha-thrombin in the absence or presence of protease-activated receptor 1.
19040205 2009 Protease activated receptor-1, PAR1, promotes placenta trophoblast invasion and beta-catenin stabilization.
18988801 2008 Matrix metalloproteinase-1 and thrombin differentially activate gene expression in endothelial cells via PAR-1 and promote angiogenesis.
18988770 2009 Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of angiogenesis.
18983479 2009 Mitochondrial reactive oxygen species: a common pathway for PAR1- and PAR2-mediated tissue factor induction in human endothelial cells.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18832729 2008 Neutrophil-mediated activation of epithelial protease-activated receptors-1 and -2 regulates barrier function and transepithelial migration.
18820708 2008 p53 controls hPar1 function and expression.
18687805 2008 Thrombin receptor and RhoA mediate cell proliferation through integrins and cysteine-rich protein 61.
18682394 2008 Coordinate activation of human platelet protease-activated receptor-1 and -4 in response to subnanomolar alpha-thrombin.
18657231 2009 Interleukin 8 is differently expressed and modulated by PAR-1 activation in early and late endothelial progenitor cells.
18612544 2008 Protease activated receptor 1 (PAR-1) activation by thrombin is protective in human pulmonary artery endothelial cells if endothelial protein C receptor is occupied by its natural ligand.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18570113 2008 Over-expression of the thrombin receptor (PAR-1) in the placenta in preeclampsia: a mechanism for the intersection of coagulation and inflammation.
18537828 2008 Downregulation of protease-activated receptor-1 in human lung fibroblasts is specifically mediated by the prostaglandin E receptor EP2 through cAMP elevation and protein kinase A.
18386288 2008 Protease-activated receptor-1 upregulates fibroblast growth factor 7 in stroma of benign prostatic hyperplasia.
18384756 2008 Plasmin is involved in inflammation via protease-activated receptor-1 activation in human dental pulp.
18372913 2008 Persistent transactivation of EGFR and ErbB2/HER2 by protease-activated receptor-1 promotes breast carcinoma cell invasion.
18363813 2008 Protease activated receptor 1 activation of platelet is associated with an increase in protein kinase CK2 activity.
18314110 2009 The production of vascular endothelial growth factor and metalloproteinase via protease-activated receptor in human endometrial stromal cells.
18308730 2008 Kallikrein-related peptidase 4 (KLK4) initiates intracellular signaling via protease-activated receptors (PARs). KLK4 and PAR-2 are co-expressed during prostate cancer progression.
18284602 2008 Lipid raft localization regulates the cleavage specificity of protease activated receptor 1 in endothelial cells.
18278202 2008 Failure to validate association of gene polymorphisms in EPCR, PAR-1, FSAP and protein S Tokushima with venous thromboembolism among Californians of European ancestry.
18179608 2008 Proteinase-activated receptor-1 (PAR(1)) and PAR(2) but not PAR(4) mediate contraction in human and guinea-pig gallbladders.
18174463 2008 Factor Xa binding to annexin 2 mediates signal transduction via protease-activated receptor 1.
18089851 2008 Activated protein C-cleaved protease activated receptor-1 is retained on the endothelial cell surface even in the presence of thrombin.
18064407 2008 Mutation-prone points in thrombin receptor.
18005014 2008 Effect of a thrombin receptor (protease-activated receptor 1, PAR-1) gene polymorphism in chronic hepatitis C liver fibrosis.
17935246 2007 Association study of protease activated receptor 1 gene polymorphisms and adverse pregnancy outcomes: results of a pilot study in Israel.
17895623 2007 Statins increase risk of hemorrhagic stroke by inhibition of the PAR-1 receptor.
17883592 2007 Protease-activated receptor-induced Akt activation--regulation and possible function.
17848177 2007 Tissue factor induction by protease-activated receptor 1 requires intact caveolin-enriched membrane microdomains in human endothelial cells.
17823308 2007 The ligand occupancy of endothelial protein C receptor switches the protease-activated receptor 1-dependent signaling specificity of thrombin from a permeability-enhancing to a barrier-protective response in endothelial cells.
17721620 2007 Tyrosine phosphorylation / dephosphorylation balance is involved in thrombin-evoked microtubular reorganisation in human platelets.
17706138 2007 [Functional aspects of protease-activated receptor 1 in promoting metastasis of lung cancer].
17675516 2007 Porphyromonas gingivalis selectively up-regulates the HIV-1 coreceptor CCR5 in oral keratinocytes.
17623652 2007 Trypsin IV or mesotrypsin and p23 cleave protease-activated receptors 1 and 2 to induce inflammation and hyperalgesia.
17492768 2007 PAR1-mediated RhoA activation facilitates CCL2-induced chemotaxis in PC-3 cells.
17470200 2007 Transcriptional program induced by factor VIIa-tissue factor, PAR1 and PAR2 in MDA-MB-231 cells.
17414212 2007 Protease-activated receptor signaling: new roles and regulatory mechanisms.
17404307 2007 Mold allergen, pen C 13, induces IL-8 expression in human airway epithelial cells by activating protease-activated receptor 1 and 2.
17384202 2007 Tissue factor trafficking in fibroblasts: involvement of protease-activated receptor-mediated cell signaling.
17376866 2007 Protease-activated receptor-3 (PAR3) regulates PAR1 signaling by receptor dimerization.
17374729 2007 Protease-activated receptor-1 (hPar1), a survival factor eliciting tumor progression.
17373694 2007 Overexpression of protease-activated receptors-1,-2, and-4 (PAR-1, -2, and -4) in prostate cancer.
17347481 2007 Retrospective analysis of coagulation factor II receptor (F2R) sequence variation and coronary heart disease in hypertensive patients.
17323377 2007 Thrombin-mediated hepatocellular carcinoma cell migration: cooperative action via proteinase-activated receptors 1 and 4.
17303701 2007 PAR1, but not PAR4, activates human platelets through a Gi/o/phosphoinositide-3 kinase signaling axis.
17294805 2006 In vitro study of low molecular weight heparin effect on cell growth and cell invasion in primary cell cultures of high-grade gliomas.
17267663 2007 Real-time analysis of agonist-induced activation of protease-activated receptor 1/Galphai1 protein complex measured by bioluminescence resonance energy transfer in living cells.
17015787 2006 Direct vascular effects of protease-activated receptor type 1 agonism in vivo in humans.
16952995 2006 Protease-activated receptors in cardiovascular diseases.
16946713 2007 Quantitative analysis of melanocytic tissue array reveals inverse correlation between activator protein-2alpha and protease-activated receptor-1 expression during melanoma progression.
16839349 2006 Thrombin generation during reperfusion after coronary artery bypass surgery associates with postoperative myocardial damage.
16837456 2006 PAR4, but not PAR1, signals human platelet aggregation via Ca2+ mobilization and synergistic P2Y12 receptor activation.
16803467 2006 The angiopoietin pathway is modulated by PAR-1 activation on human endothelial progenitor cells.
16709572 2006 Ca2+ influx induced by protease-activated receptor-1 activates a feed-forward mechanism of TRPC1 expression via nuclear factor-kappaB activation in endothelial cells.
16606835 2006 Cysteinyl leukotriene 2 receptor and protease-activated receptor 1 activate strongly correlated early genes in human endothelial cells.
16409451 2006 Thrombin generation in vascular tissue.
16407403 2006 An essential role for SNX1 in lysosomal sorting of protease-activated receptor-1: evidence for retromer-, Hrs-, and Tsg101-independent functions of sorting nexins.
16359518 2005 Protease-activated receptors-1 and -2 can mediate endothelial barrier protection: role in factor Xa signaling.
16354660 2006 Role of the PAR1 receptor 8th helix in signaling: the 7-8-1 receptor activation mechanism.
16354200 2005 Endothelial protein C receptor and protease-activated receptor-1 mediate induction of a wound-healing phenotype in human keratinocytes by activated protein C.
16341594 2005 p42(IP4)/centaurin alpha1, a brain-specific PtdIns(3,4,5)P3/Ins(1,3,4,5)P4-binding protein: membrane trafficking induced by epidermal growth factor is inhibited by stimulation of phospholipase C-coupled thrombin receptor.
16194864 2005 PAR-1 genotype influences platelet aggregation and procoagulant responses in patients with coronary artery disease prior to and during clopidogrel therapy.
16141404 2005 PAR-1 activation on human late endothelial progenitor cells enhances angiogenesis in vitro with upregulation of the SDF-1/CXCR4 system.
16102047 2005 Protease-activated receptors in hemostasis, thrombosis and vascular biology.
16087677 2005 Plasmin- and thrombin-accelerated shedding of syndecan-4 ectodomain generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds.
16052512 2005 PAR1-mediated NFkappaB activation promotes survival of prostate cancer cells through a Bcl-xL-dependent mechanism.
16021575 2005 Expression of protease-activated receptors 1 and 2 in melanocytic nevi and malignant melanoma.
15923186 2005 Hirudin binding reveals key determinants of thrombin allostery.
15891109 2005 Proteinase-activated receptor-1 mediates elastase-induced apoptosis of human lung epithelial cells.
15878870 2005 Functional selectivity of G protein signaling by agonist peptides and thrombin for the protease-activated receptor-1.
15869604 2005 Tissue factor enhances protease-activated receptor-2-mediated factor VIIa cell proliferative properties.
15860737 2005 Rac1 regulation of surface expression of protease-activated receptor-1 and responsiveness to thrombin in vascular smooth muscle cells.
15821019 2005 PGE2 and PAR-1 in pulmonary fibrosis: a case of biting the hand that feeds you?
15769747 2005 Protease-activated receptor-1 signaling by activated protein C in cytokine-perturbed endothelial cells is distinct from thrombin signaling.
15755869 2005 Possible involvement of thrombin/protease-activated receptor 1 system in the pathogenesis of endometriosis.
15707890 2005 PAR1 is a matrix metalloprotease-1 receptor that promotes invasion and tumorigenesis of breast cancer cells.
15626732 2005 Endothelial barrier protection by activated protein C through PAR1-dependent sphingosine 1-phosphate receptor-1 crossactivation.
15625067 2004 Correlation of protease-activated receptor-1 with differentiation markers in squamous cell carcinoma of the head and neck and its implication in lymph node metastasis.
15582715 2005 Proteinase-activated receptors (PARs)--the PAR3 Neo-N-terminal peptide TFRGAP interacts with PAR1.
15563688 2005 Protease-activated receptor-1 in human lung fibroblasts mediates a negative feedback downregulation via prostaglandin E2.
15561975 2005 Protease-activated receptor stimulation activates a Ca2+-independent phospholipase A2 in bladder microvascular endothelial cells.
15559761 2004 PAR1-type thrombin receptor stimulates migration and matrix adhesion of human colon carcinoma cells by a PKCepsilon-dependent mechanism.
15550696 2005 Coagulation factor Xa stimulates interleukin-8 release in endothelial cells and mononuclear leukocytes: implications in acute myocardial infarction.
15548541 2005 Crystal structure of thrombin bound to heparin.
15522964 2005 Thrombin induces endocytosis of endoglin and type-II TGF-beta receptor and down-regulation of TGF-beta signaling in endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15455382 2005 Differential expression of protease activated receptor 1 (Par1) and pY397FAK in benign and malignant human ovarian tissue samples.
15383630 2004 Activation of proteinase-activated receptor 1 promotes human colon cancer cell proliferation through epidermal growth factor receptor transactivation.
15313016 2004 Sustained stimulation of platelet thrombin receptor is associated with tyrosine dephosphorylation of a novel p67 peptide in a manner regulated by extracellular calcium.
15280447 2004 Protease-activated receptors (PAR1 and PAR2) contribute to tumor cell motility and metastasis.
15247268 2004 Plasmin-induced migration requires signaling through protease-activated receptor 1 and integrin alpha(9)beta(1).
15191806 2004 Protease-activated receptor-1 in human brain: localization and functional expression in astrocytes.
15183114 2004 Inactivation of protease-activated receptor-1 by proteolytic removal of the ligand region in vascular endothelial cells.
15099288 2004 Role of protease-activated and ADP receptor subtypes in thrombin generation on human platelets.
15078882 2004 Contribution of protease-activated receptors 1 and 4 and glycoprotein Ib-IX-V in the G(i)-independent activation of platelet Rap1B by thrombin.
15045135 2004 Contribution of PAR-1, PAR-4 and GPIbalpha in intracellular signaling leading to the cleavage of the beta3 cytoplasmic domain during thrombin-induced platelet aggregation.
15023990 2004 A tyrosine-based sorting signal regulates intracellular trafficking of protease-activated receptor-1: multiple regulatory mechanisms for agonist-induced G protein-coupled receptor internalization.
14982936 2004 Regulated shedding of PAR1 N-terminal exodomain from endothelial cells.
14966279 2004 Persistent signaling by dysregulated thrombin receptor trafficking promotes breast carcinoma cell invasion.
14961162 2004 Platelets in patients with acute ischemic stroke are exhausted and refractory to thrombin, due to cleavage of the seven-transmembrane thrombin receptor (PAR-1).
14642534 2003 Differential Ca(2+)responses induced by thrombin and thrombin-receptor agonist peptides in HSY-EA1 cells.
14632180 2003 Protease-activated receptor-1 (thrombin receptor) is expressed in mesenchymal portions of human hair follicle.
14623891 2004 Thrombin up-regulates tissue factor pathway inhibitor-2 synthesis through a cyclooxygenase-2-dependent, epidermal growth factor receptor-independent mechanism.
14521606 2003 Redistribution of glycoprotein Ib within platelets in response to protease-activated receptors 1 and 4: roles of cytoskeleton and calcium.
14507634 2003 Thrombin receptors and protease-activated receptor-2 in human placentation: receptor activation mediates extravillous trophoblast invasion in vitro.
13680213 2004 Thrombin induces Sp1-mediated antiviral effects in cytomegalovirus-infected human retinal pigment epithelial cells.
12975361 2003 Loss of activator protein-2alpha results in overexpression of protease-activated receptor-1 and correlates with the malignant phenotype of human melanoma.
12883880 2003 Expression of functional protease-activated receptor 1 in human prostate cancer cell lines.
12832443 2003 Expression of and functional responses to protease-activated receptors on human eosinophils.
12805069 2003 Differential expression and regulation of protease-activated receptors in human peripheral monocytes and monocyte-derived antigen-presenting cells.
12789289 2003 Role and regulation of the thrombin receptor (PAR-1) in human melanoma.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12737439 2003 Expression and cytoprotective effect of protease-activated receptor-1 in gastric epithelial cells.
12707033 2003 Aberrant expression and activation of the thrombin receptor protease-activated receptor-1 induces cell proliferation and motility in human colon cancer cells.
12637343 2003 Human protease-activated receptor 1 expression in malignant epithelia: a role in invasiveness.
12594292 2003 Up-regulation of proteinase-activated receptor 1 expression in astrocytes during HIV encephalitis.
12586611 2003 Activated protein C alters cytosolic calcium flux in human brain endothelium via binding to endothelial protein C receptor and activation of protease activated receptor-1.
12563219 2003 The cleaved peptide of PAR1 is a more potent stimulant of platelet-endothelial cell adhesion than is thrombin.
12534282 2003 Protease-activated receptor mediated RhoA signaling and cytoskeletal reorganization in LNCaP cells.
12522081 2003 Unproductive cleavage and the inactivation of protease-activated receptor-1 by trypsin in vascular endothelial cells.
12505789 2003 PAR1-dependent and independent increases in COX-2 and PGE2 in human colonic myofibroblasts stimulated by thrombin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406873 2003 An intronic polymorphism in the PAR-1 gene is associated with platelet receptor density and the response to SFLLRN.
12372769 2002 Phospholipid metabolite production in human urothelial cells after protease-activated receptor cleavage.
12370395 2002 House dust mite allergens induce proinflammatory cytokines from respiratory epithelial cells: the cysteine protease allergen, Der p 1, activates protease-activated receptor (PAR)-2 and inactivates PAR-1.
12195707 2002 Protease-activated receptors upregulate cyclooxygenase-2 expression in human endothelial cells.
12084570 2002 A noncoding RNA regulates human protease-activated receptor-1 gene during embryogenesis.
12058063 2002 Down-regulation of protease-activated receptor-1 is regulated by sorting nexin 1.
12052963 2002 Activation of endothelial cell protease activated receptor 1 by the protein C pathway.
12039967 2002 Thrombin receptors activate G(o) proteins in endothelial cells to regulate intracellular calcium and cell shape changes.
12023853 2002 Role of thrombin and its major cellular receptor, protease-activated receptor-1, in pulmonary fibrosis.
11986954 2002 B-CLL cells are capable of synthesis and secretion of both pro- and anti-angiogenic molecules.
11907122 2002 Activation of protease-activated receptor (PAR)-1, PAR-2, and PAR-4 stimulates IL-6, IL-8, and prostaglandin E2 release from human respiratory epithelial cells.
11816709 2001 Role of protease-activated receptor 1 in tumor metastasis promoted by tissue factor.
11447194 2001 Arginine-specific protease from Porphyromonas gingivalis activates protease-activated receptors on human oral epithelial cells and induces interleukin-6 secretion.
11278329 2001 Tumor cell invasion is promoted by activation of protease activated receptor-1 in cooperation with the alpha vbeta 5 integrin.
10978167 2000 Proteolysis of the exodomain of recombinant protease-activated receptors: prediction of receptor activation or inactivation by MALDI mass spectrometry.
10922491 2000 Acylation of Galpha(13) is important for its interaction with thrombin receptor, transforming activity and actin stress fiber formation.
10692450 2000 Thrombin inhibits tumor cell growth in association with up-regulation of p21(waf/cip1) and caspases via a p53-independent, STAT-1-dependent pathway.
10644723 2000 PAR1 thrombin receptor-G protein interactions. Separation of binding and coupling determinants in the galpha subunit.
10583385 1999 Activation of the rod G-protein Gt by the thrombin receptor (PAR1) expressed in Sf9 cells.
10477691 1999 Dichotomous regulation of myosin phosphorylation and shape change by Rho-kinase and calcium in intact human platelets.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10079109 1999 Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin.
9701242 1998 Thrombin receptor overexpression in malignant and physiological invasion processes.
9639571 1998 Thrombin stimulates fibroblast procollagen production via proteolytic activation of protease-activated receptor 1.
9207393 1997 The human thrombin receptor and proteinase activated receptor-2 genes are tightly linked on chromosome 5q13.
9102146 1996 [Role of thrombin and its receptor in the pathogenesis of severe forms of human glomerulonephritis with fibrin deposits].
9058715 1997 Specific inhibition of thrombin-induced cell activation by the neutrophil proteinases elastase, cathepsin G, and proteinase 3: evidence for distinct cleavage sites within the aminoterminal domain of the thrombin receptor.
9038223 1997 Thrombin receptors on human platelets. Initial localization and subsequent redistribution during platelet activation.
8982657 1996 Direct evidence for two distinct G proteins coupling with thrombin receptors in human neuroblastoma SH-EP cells.
8955127 1996 Role of the thrombin receptor's cytoplasmic tail in intracellular trafficking. Distinct determinants for agonist-triggered versus tonic internalization and intracellular localization.
8824285 1996 Cloning and identification of regulatory sequences of the human thrombin receptor gene.
8621593 1996 Genomic cloning and characterization of the human thrombin receptor gene. Structural similarity to the proteinase activated receptor-2 gene.
8395910 1993 Chromosomal assignment of the human thrombin receptor gene: localization to region q13 of chromosome 5.
8395550 1993 Response of blood leukocytes to thrombin receptor peptides.
8290554 1994 G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets.
8136362 1994 Crystallographic structures of thrombin complexed with thrombin receptor peptides: existence of expected and novel binding modes.
7961693 1994 Intracellular targeting and trafficking of thrombin receptors. A novel mechanism for resensitization of a G protein-coupled receptor.
7834643 1995 Solid tumor cells express functional "tethered ligand" thrombin receptor.
1851174 1991 The G protein coupled to the thromboxane A2 receptor in human platelets is a member of the novel Gq family.
1672265 1991 Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation.
1310691 1992 Characterization of a functional thrombin receptor. Issues and opportunities.