Property Summary

NCBI Gene PubMed Count 168
PubMed Score 487.29
PubTator Score 598.64

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (16)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
679 confirmatory 21 / 0 / 73 Factor XIa Dose Response Confirmation
680 screening 120 / 0 / 61986 Factor XIa Mixture HTS
687 screening 94 / 0 / 32975 Factor XIa Single Well HTS
721 confirmatory 21 / 0 / 73 Factor XIa Dose Response Confirmation from Single Well Screen
798 screening 302 / 0 / 218482 Factor XIa 1536 HTS
846 confirmatory 91 / 13 / 198 Factor XIa 1536 HTS Dose Response Confirmation

Gene RIF (127)

PMID Text
26769048 FXI-thrombin axis contributes to distal platelet activation and procoagulant microaggregate formation in the blood flow downstream of the site of thrombus formation.
26386215 higher basal factor XI concentration in the general population is not a risk marker for stroke or coronary heart disease
26260105 In whites, the FXI variant was associated with both factor XI concentration and venous thromboembolism (VTE) incidence (1.15-fold greater incidence of VTE per risk allele), whereas In African-Americans, these associations were absent.
26160656 ROTEM assays failed to distinguish bleeding from non-bleeding patients but could do so between different FXI activity levels and genotypes.
26136249 Contribution of FXIa and platelet-derived polyphosphate in thrombin generation varies depending on surface tissue-factor level.
25976967 Data indicate that the mean factor XI (FXI) was not significantly different in laboratories using the same method on both exercises, suggesting good intralaboratory precision over time.
25935648 These studies enhance understanding on the first allosteric inhibitor of FXIa and highlight its value as a promising anticoagulant.
25681615 study determined the molecular basis of FXI deficiency in 6 unrelated severely deficient patients in China; reported 8 mutations in FXI gene leading to FXI deficiency; functional consequences of a novel mutation leading to FXI deficiency have been elucidated
25618263 Identification of a novel c.290G>A mutation in the F11 gene that is associated with mild Factor XI deficiency in a Dutch Caucasian family.
25517908 increased activity of FXI may be a potential risk factor for miscarriage; high activity of FXI diagnosed in women with history of miscarriage is not probably caused by the presence of SNPs rs2289252 and rs2036914
25379760 FXI expression is directly regulated by a specific miRNA, miR-181a-5p, in the human liver
25338662 Polyphosphate greatly accelerates factor V activation by factor XIa, and that this is supported by polyphosphate polymers of the size secreted by activated human platelets.
25288467 This study presents the first application of a new thrombin generation based factor XIa assay.
25092234 Mass spectrometry analyses of FXI revealed full occupation of two of the three heavy-chain glycosites and almost full-site occupancy of the light chain. Analysis of FXI glycopeptides by LC-MS/MS enabled site-specific glycan profiling and occupancy.
25091233 F11 gene variant rs2289252 contributes to inherited forms of deep vein thrombosis incidence in Latvian population.
24977287 FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either
24759143 This review discuss structural features of factor XIa that are required for factor IX activation, and the importance of the protease's dimeric structure. [review]
24509324 Factor XI and factor XII activities were significantly higher in patients with slow coronary flow than in controls, and could be associated with enhanced procoagulant state present in these patients.
24498168 Circulating contact-pathway-activating microparticles together with factors IXa and XIa induce spontaneous clotting in plasma of hematology and cardiologic patients.
24420855 We suggested that the minor allele of rs3756008 in the promoter of FXI gene could reduce its expression in kidney.
24112640 at variance with other populations, no single major founder effect is present in Italian patients with FXI deficiency.
24086496 Genetic variants of coagulation factor XI show association with ischemic stroke up to 70 years of age.
23929304 Studies indicate that in the past two decades, more than 220 mutations in the factor XI (FXI) gene have been reported in patients with FXI deficiency, of which 7 showed a founder effect.
23659638 Propose that long polyphosphates promote FXII-mediated blood coagulation bypassing FXI.
23617568 The results suggest the Omega-loop of FIX binds to an area on FXIa composed of residues from the N-terminus and C-terminus of the A3 domain. These residues are buried in zymogen FXI, and must be exposed upon conversion to FXIa to permit FIX binding.
23571684 Identification of a novel candidate F11 gene mutation associated with a cross-reacting material positive plasma FXI deficiency.
23515926 For activation by thrombin, or during autoactivation, the data support a cis-activation mechanism in which the activating protease binds to and activates the same fXI subunit.
23494098 a novel mutations in family with inherited factor XI deficiency
23332144 The rather rare type I mutation in the FXI gene is a third founder mutation in Ashkenazi Jews with factor XI deficiency.
23305485 F11 gene mutational screening revealed 11 different DNA variations, 3 of which had not yet been described
22961984 Results indicate that fXIa activates fIX by an exosite- and Ca(2+)-mediated release-rebind mechanism.
22704541 Factor XI is a substrate for oxidoreductases: enhanced activation of reduced FXI is found in antiphospholipid syndrome thrombosis.
22633531 The F11 rs2289252 polymorphism is associated with FXI activity levels and APTT ratio in women with thrombosis.
22505407 two structures of FXIa in complex with nonbasic inhibitors that occupy both the prime and nonprime sides of the active site are presented
22322133 A novel amino acid substitution in the serine protease catalytic domain (Ile463Ser) appears to be responsible for the congenital factor XI deficiency in a Swiss family.
22207756 Partial reduction of FXIa/S557A to produce heavy and light chains resulted in decreased FIX binding, and this function was regained upon reformation of the disulfide linkage between the heavy and the light chains.
22159456 analysis of nine new mutations and an original large 4qTer deletion in western Brittany (France) with a possible role in factor XI deficiency
21999818 The new mutation (Ile 436 Lys) was present in five patients with FXI deficiency at the homozygote level and in one patient as a compound heterozygote with an already known mutation namely Glu 117 stop.
21820158 Circulating active TF and FXIa can occur in patients with cerebrovascular ischemic events >/=6 months after the events. The presence of these factors is associated with worse functional outcomes, persistent hypercoagulable state in cerebrovascular disease.
21718436 present findings define a new mechanism of mutations in F11 and underscore the need to perform expression studies and mRNA analysis of point mutations before stating that they are missense mutations
21668437 The high frequency of the Q263X mutation in Korean patients with FXI deficiency and the presence of significant difference in the frequency of the mutation-bearing haplotype between the control and patient groups revealed a founder effect of the mutation.
21649796 Molecular analysis of whole coding region and splice junctions of F11 gene in three FXI deficient patients and their family members.
21527525 Forms of thrombin other than alpha-thrombin contribute directly to feedback activation of FXI in plasma.
21236471 Active FXI and tissue factor are present in stable chronic obstructive pulmonary disease patients, who exhibit enhanced systemic inflammation and thrombin generation.
21192253 In a Chinese family two new mutations were found: a heterozygous missense mutation in the Factor XI gene; and a deletion of two nucleotides resulting in frameshift mutation and premature termination of transcription in the Factor XII gene.
21057700 Suggest that severe FXI deficiency provides protection against deep vein thrombosis.
20961395 TAFI plays an important role in platelet mediated resistance to fibrinolysis via feedback activation of factor XI.
20727068 Coagulation factor XI has a role in thrombosis and it may be a novel target for antithrombotic treatment [review]
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20589316 FXIa inhibitor did not prevent tissue factor-induced platelet aggregation.
20523169 molecular basis (ie. FIX mutations) of FXI deficiency in 16 patients from 12 families originating from the Marseilles area in the south of France was studied
20491955 two novel mutations (Cys118Arg and Trp497Gly)in patients from Southern Italy with FXI deficiency
20456758 FXIa activates both procofactors recombinant FVIII and plasma FV at plasma protein concentrations
20352152 genetic polymorphism is associated with idiopathic venous thromboembolism
20352152 Observational study of gene-disease association. (HuGE Navigator)
20308231 Molecular characterization of FXI deficiency.
20128871 Observational study of gene-disease association. (HuGE Navigator)
20110423 4 "apple domains" for a disk structure with extensive interfaces at the base of the catalytic domain. The characterization of this structure & its mutations provide new insight into F11 activation, interaction with F9, & platelet binding. Review.
20042724 The coupling of alternative splicing and nonsense-mediated mRNA decay may play a role in regulating F11 expression, and point to the existence of a novel FXI isoform.
20015217 the pathogenic mechanism underlying the Thr33Pro and Gly217Ser mutations in patients with FXI deficiency
19913121 Observational study of gene-disease association. (HuGE Navigator)
19718484 Analysis of the structural effects of four novel and a previously known mutations causing factor XI deficiency
19682239 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19661487 apolipoprotein E receptor 2 (ApoER2, LRP8), a member of the LDL receptor family, is a platelet receptor for FXI.
19652879 A total of 70 apple domain (Ap) missense mutations were analysed using a consensus Ap domain structure generated from the FXI dimer crystal structure. This showed that all parts of the Ap domain were affected.
19617576 Elevated level of factor XI is associated with venous thromboembolism.
19583818 Two SNPs, rs2289252 and rs2036914 in F11, appear to independently contribute to the risk of DVT, a contribution that is explained at least in part by an association with FXI levels.
19351955 An antibody that blocks fXIa activation of factor IX reduced thrombin generation
18839438 FXI deficiency in non-Jewish populations is because of different gene mutations; however, the presence of the Glu117stop and Phe283Leu mutations suggests that genetic testing in FXI-deficient patients can start with these two point mutations
18832909 Val498Met is a novel missense mutation, and the Tyr503ValfsX32 mutation was reported in a Japanese patient. Mutations occurred in the exon 13 of F11 and were believed to disrupt the catalytic domain of the FXI protein, leading to severe FXI deficiency.
18612554 Describe factor XI expression in liver, pancreas and kidney.
18515884 inherited FXI deficiency in the Abruzzo Region of Italy has a heterogeneous genetic background and no single predominant mutation could be identified
18441012 The dimeric structure of FXI is essential for normal proteolytic activation of FXI by FXIIa, thrombin, or FXIa either in solution or on an anionic surface but not for FIX activation by FXIa in solution.
18388506 3 cases of quantitative factor XI deficiency in relation with four novel missense mutations are reported
18387979 Observational study of gene-disease association. (HuGE Navigator)
18327400 the functional consequences of two splicing mutations leading to FXI deficiency have been elucidated; a novel missense mutation in the FIX-binding region of the FXI A3 domain leading to a CRM+ deficiency is reported
18268095 Severe factor XI deficiency probably is protective against ischemic stroke but not against acute myocardial infarction.
18217146 The majority of coronary artery disease patients had circulating FXIa that correlates with markers of coagulation and inflammation.
18192270 two forms of activated factor XI are generated during coagulation, and each half of a factor XIa dimer behaves as an independent enzyme with respect to factor IX
18186617 enzyme activity is impaired in FXIa when Gly193 is replaced by a non-Gly residue, and residues with side chains that branch at the beta-carbon have the greatest effect on catalysis and binding of substrates.
18024374 five FXI missense mutations (four novel) were associated with impaired secretion albeit normal dimerization, underscoring the existence of other mechanisms for defective secretion
18020374 Data support the conclusion that a conformational transition accompanies conversion of factor XI to factor XIa that exposes the factor XIa (enzyme) platelet binding site within the catalytic domain possibly comprising residues Cys527-Cys542.
18005151 Nine different F11 mutations were detected among which seven changes were not previously reported
17768109 ADAMTS13/FXI complexes are insignificant in plasma
17652512 activation of FXI by thrombin in solution or on the surface of activated platelets does not appear to play a significant role in a plasma environment
17597996 review of the role of FXI in thrombosis and hemostasis, and the etiology and antithrombotic effect of FXI deficiency
17581330 a novel mutation, a C-to-G transition at position 1394 in exon 12 in the FXI gene (F11 c.1394 C>G). This transition resulted in a missense mutation (Gln433Glu), which led to the disruption of the catalytic domain structure of the FXI molecule.
17549289 Report five missense mutations of Factor XI as being causative of factor XI deficiency.
17284699 Observational study of gene-disease association. (HuGE Navigator)
17257616 the F283L mutation leads to increased dimer dissociation by stabilizing a monomeric state with altered side-chain packing that is unfavorable for homodimer formation
17229051 coagulation factor XI (FXIP520L) has a proline to leucine substitution at residue 520, which results in a catalytic defect
16878977 The results demonstrate that basic amino acids in the autolysis loop of fXIa are important determinants of serpin specificity.
16835901 31 novel mutations in the F11 gene are associated with Factor XI deficiency.
16613788 Observational study of gene-disease association. (HuGE Navigator)
16330457 In 3 cases, the Glu117stop mutation caused a quantitative deficiency of factor XI by reducing mRNA levels.
16204896 crystallographic analysis of Factor XI with mutated surface residues bound to benzamidine
16085935 Arg15, Phe34, Pro13, and Arg20 are important for FXIa inhibition by PN2 Kunitz protease inhibitor domain
16079124 Six novel missense mutations were identified in factor XI deficiency.
16042419 For optimal rates of factor IX activation in solution or on the physiologically relevant surface of activated platelets, a preformed dimer of factor XI is not required.
15870541 To provide a complete database of mutations and polymorphisms associated with factor XI deficiency, all available data on hereditary factor XI deficiency from main biological and medical databases were collected
15842381 analysis of missense mutations in two patients with factor XI deficiency (Val271Leu and Tyr351Ser) and one patient with combined factor XI and factor IX deficiency (Phe349Val)[letter]
15634276 structural characterization of FXI disease-causing mutations to complement phenotypic ata
15545266 Crystal structures of the FXIa catalytic domain complexed to ecotin mutants
15456490 Glu555 alters the electrostatic charge around the active site, and would sterically interfere with the interaction between the FXIa site and residues on F9 and antithrombin. FXI-Glu555 is the first reported FXI variant with a defect in FIX activation.
15456480 the platelets of both normal and FXI deficient individuals contain FXI mRNA that is identical to the mRNA found in liver; the FXI message is not alternatively spliced in platelets
15456479 nature of possible platelet-associated FXI activity
15375170 FXI binds to glycoprotein Ibalpha at sites comprising the leucine-rich repeat sequences within the NH2-terminal globular domain that are separate and distinct from the thrombin-binding site
15317813 binding of FXI to GPIbalpha is mediated by amino acids in the A3 domain in the presence or absence of HK.
15226185 whole gene deletion as the causative mutation of factor XI deficiency, the result of unequal homologous recombination between flanking Alu repeat sequences
15182578 The FXI gene mutations Trp228stop, Glu323Lys and Leu172Pro attribute to the pathogenesis of the factor XI deficiency in Chinese.
15090552 Data describe the structural role of glycine(193) in the serine protease, factor XIa.
15072993 Platelet-localized feedback activation of factor XI by thrombin plays an important role in maintaining normal hemostasis as well as in sustaining thrombus formation when the TF pathway is inhibited by tissue factor pathway inhibitor.
14717969 new ancient mutation in exon 4 resulting in Q88X, specific to patients from Nantes, France
14629467 The data indicate that FXI domains A2 and A3 make contributions to dimer formation and stabilize this dimeric conformation
14521595 high levels of coagulation FXI, FIX and FVIII are related to risk of inherited thrombophilia syndrome
14521591 FXI has no effect on thrombin generation at 10 pm TF and physiological concentrations of Vitamin K-Dependent Proteins (VKDP); platelets and plasma FXI are able to compensate for the inhibitory effects of elevated VKDP
12968031 the co-localization of thrombin and factor XI and the resultant efficient activation of FXI requires GPIb alpha
12944405 prekallikrein abolished Factor XI or -Factor XIa binding to vascular endothelial cell suspensions
12871398 The frequency distributions of platelet polymorphisms and of prothrombotic polymorphisms were not different between patients with severe FXI deficiency who experienced or not an AMI.
12517745 factor XI is localized to GPIb in membrane rafts and that this association is important for promoting the activation of factor XI by thrombin on the platelet surface
12496253 role of factor IX gamma-carboxyglutamic acid domain in interactions between factor IX and factor XIa
12372819 plasma kallikrein and FXIa activate pro-HGF in vitro
12167623 Data show that the rate of factor IX activation by factor XIa is not enhanced by biological surfaces, and activated platelet surfaces are thrombogenic while endothelial surfaces are not.
12029092 interaction of coagulation factor XI with human umbilical vein endothelial cells (HUVEC) and with platelets
11895778 Observational study of genotype prevalence. (HuGE Navigator)
11891231 role of HNF-4alpha in hepatocyte-specific expression
11733491 HK binding to FXI involves multiple apple domains, with F2 being most important. The findings demonstrate a similarity in mechanism for FXI and prekallikrein binding to HK

AA Sequence

MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDP      1 - 70
TRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERC     71 - 140
TDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVF    141 - 210
ADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSL    211 - 280
QSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL    281 - 350
SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI    351 - 420
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTV    421 - 490
NYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC    491 - 560
AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV         561 - 625
//

Text Mined References (177)

PMID Year Title
26769048 2016 Coagulation Factor XI Promotes Distal Platelet Activation and Single Platelet Consumption in the Bloodstream Under Shear Flow.
26386215 2015 Lack of association of plasma factor XI with incident stroke and coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) Study.
26260105 2015 Prospective study of circulating factor XI and incident venous thromboembolism: The Longitudinal Investigation of Thromboembolism Etiology (LITE).
26160656 2015 The impact of thrombin generation and rotation thromboelastometry on assessment of severity of factor XI deficiency.
26136249 2015 FXIa and platelet polyphosphate as therapeutic targets during human blood clotting on collagen/tissue factor surfaces under flow.
25976967 2015 Quality of factor XI activity testing in North American Specialized Coagulation Laboratories.
25935648 2015 Allosteric inhibition of factor XIa. Sulfated non-saccharide glycosaminoglycan mimetics as promising anticoagulants.
25681615 2015 Genetic analysis in Factor XI deficient patients from central China: identification of one novel and seven recurrent mutations.
25618263 2015 A novel c.290G>A mutation in the Factor 11 gene in a Dutch Caucasian family with a Factor XI deficiency.
25517908 2015 Activity of coagulation factor XI in patients with spontaneous miscarriage: the presence of risk alleles.
25379760 2014 Regulation of coagulation factor XI expression by microRNAs in the human liver.
25338662 2015 Polyphosphate accelerates factor V activation by factor XIa.
25288467 2014 Increased factor XIa levels in patients with a first acute myocardial infarction: the introduction of a new thrombin generation based factor XIa assay.
25158988 2015 Molecular basis and bleeding manifestations of factor XI deficiency in 11 Turkish families.
25092234 2014 Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite.
25091233 2014 Association of F11 polymorphism rs2289252 with deep vein thrombosis and related phenotypes in population of Latvia.
24977287 2014 Antigen levels of coagulation factor XII, coagulation factor XI and prekallikrein, and the risk of myocardial infarction and ischemic stroke in young women.
24759143 2014 The mechanism underlying activation of factor IX by factor XIa.
24509324 2015 Plasma factor XI and XII activity in patients with slow coronary flow.
24498168 2014 Circulating contact-pathway-activating microparticles together with factors IXa and XIa induce spontaneous clotting in plasma of hematology and cardiologic patients.
24420855 2014 Functional investigation of a venous thromboembolism GWAS signal in a promoter region of coagulation factor XI gene.
24112640 2014 The spectrum of factor XI deficiency in Italy.
24086496 2013 Genetic variants of coagulation factor XI show association with ischemic stroke up to 70 years of age.
23929304 2013 Congenital factor XI deficiency: an update.
23659638 2013 Factor XII promotes blood coagulation independent of factor XI in the presence of long-chain polyphosphates.
23650146 2013 A genome-wide association study for venous thromboembolism: the extended cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
23617568 2013 Analysis of the factor XI variant Arg184Gly suggests a structural basis for factor IX binding to factor XIa.
23571684 2013 A novel heterozygous missense mutation (His127Arg) in a family with inherited cross-reacting material positive factor XI deficiency.
23515926 2013 The dimeric structure of factor XI and zymogen activation.
23494098 2013 Identification of a novel factor XI gene mutational event in a Dutch Caucasian family with inherited factor XI deficiency.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23332144 2013 Type I mutation in the F11 gene is a third ancestral mutation which causes factor XI deficiency in Ashkenazi Jews.
23305485 2013 Genetic analysis in FXI deficient patients from northwestern Italy: three novel and one recurrent mutation.
22961984 2012 A sequential mechanism for exosite-mediated factor IX activation by factor XIa.
22704541 2012 Factor XI is a substrate for oxidoreductases: enhanced activation of reduced FXI and its role in antiphospholipid syndrome thrombosis.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22633531 2012 The F11 rs2289252 polymorphism is associated with FXI activity levels and APTT ratio in women with thrombosis.
22505407 2012 High-resolution crystal structures of factor XIa coagulation factor in complex with nonbasic high-affinity synthetic inhibitors.
22322133 2012 Identification of a novel F11 missense mutation (Ile463Ser) in a family with congenital factor XI deficiency.
22207756 2012 Productive recognition of factor IX by factor XIa exosites requires disulfide linkage between heavy and light chains of factor XIa.
22159456 2012 Revisiting the molecular epidemiology of factor XI deficiency: nine new mutations and an original large 4qTer deletion in western Brittany (France).
22016685 2011 A novel missense mutation Asp506Gly in Exon 13 of the F11 gene in an asymptomatic Korean woman with mild factor XI deficiency.
21999818 2012 A cluster of factor XI-deficient patients due to a new mutation (Ile 436 Lys) in northeastern Italy.
21980494 2011 Genetics of venous thrombosis: insights from a new genome wide association study.
21820158 2011 Circulating activated factor XI and active tissue factor as predictors of worse prognosis in patients following ischemic cerebrovascular events.
21718436 2011 Point mutations regarded as missense mutations cause splicing defects in the factor XI gene.
21668437 2012 Population-specific spectrum of the F11 mutations in Koreans: evidence for a founder effect.
21649796 2011 Molecular analysis of severe factor XI deficiency in three Italian patients.
21527525 2011 Activation of factor XI by products of prothrombin activation.
21457405 2011 Three dominant-negative mutations in factor XI-deficient patients.
21236471 2011 Activated factor XI and tissue factor in chronic obstructive pulmonary disease: links with inflammation and thrombin generation.
21192253 2011 Genetic analysis of a pedigree with combined factor XII and factor XI deficiency.
21057700 2011 Patients with severe factor XI deficiency have a reduced incidence of deep-vein thrombosis.
20961395 2011 The role of thrombin activatable fibrinolysis inhibitor and factor XI in platelet-mediated fibrinolysis resistance: a thromboelastographic study in whole blood.
20727068 2010 Coagulation factor XI as a novel target for antithrombotic treatment.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20589316 2010 Apixaban, a direct factor Xa inhibitor, inhibits tissue-factor induced human platelet aggregation in vitro: comparison with direct inhibitors of factor VIIa, XIa and thrombin.
20523169 2009 Prospective analysis of factor XI deficiencies in the Marseilles area identified four novel mutations among 12 consecutive unrelated families.
20491955 2010 Factor XI deficiency: two novel mutations in asymptomatic Italian patients.
20456758 2010 Coagulation procofactor activation by factor XIa.
20352152 2010 Association of common genetic variations and idiopathic venous thromboembolism. Results from EDITh, a hospital-based case-control study.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20308231 2011 Molecular characterization of FXI deficiency.
20128871 2010 Gene variants associated with venous thrombosis: confirmation in the MEGA study.
20110423 2010 Structure and function of factor XI.
20042724 2010 Molecular characterization of in-frame and out-of-frame alternative splicings in coagulation factor XI pre-mRNA.
20015217 2010 Characterization of the genetic basis of FXI deficiency in two Turkish patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19718484 2009 Analysis of the structural effects of four novel and a previously known mutations causing factor XI deficiency.
19682239 2009 Replication of findings on the association of genetic variation in 24 hemostasis genes and risk of incident venous thrombosis.
19661487 2009 Identification of coagulation factor XI as a ligand for platelet apolipoprotein E receptor 2 (ApoER2).
19652879 2009 Structural analysis of eight novel and 112 previously reported missense mutations in the interactive FXI mutation database reveals new insight on FXI deficiency.
19617576 2009 Coagulation factors IX through XIII and the risk of future venous thrombosis: the Longitudinal Investigation of Thromboembolism Etiology.
19583818 2009 Genetic variants associated with deep vein thrombosis: the F11 locus.
19351955 2009 Factor XI contributes to thrombin generation in the absence of factor XII.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18839438 2008 Factor XI gene mutations in factor XI deficient patients of the Czech Republic.
18832909 2008 Severe factor XI deficiency in a Korean woman with a novel missense mutation (Val498Met) and duplication G mutation in exon 13 of the F11 gene.
18612554 2008 Factor XI protein in human pancreas and kidney.
18515884 2008 Severe factor XI deficiency in the Abruzzo region of Italy is associated to different FXI gene mutations.
18510371 2008 Clavatadine A, a natural product with selective recognition and irreversible inhibition of factor XIa.
18441012 2008 Factor XI homodimer structure is essential for normal proteolytic activation by factor XIIa, thrombin, and factor XIa.
18388506 2008 Four novel FXI gene mutations in three factor XI- deficient patients.
18387979 2008 Simultaneous genotyping of coagulation factor XI type II and type III mutations by multiplex real-time polymerase chain reaction to determine their prevalence in healthy and factor XI-deficient Italians.
18327400 2008 Molecular characterization of two novel mutations causing factor XI deficiency: A splicing defect and a missense mutation responsible for a CRM+ defect.
18268095 2008 Reduced incidence of ischemic stroke in patients with severe factor XI deficiency.
18217146 2008 Factor XIa and tissue factor activity in patients with coronary artery disease.
18192270 2008 Characterization of Novel Forms of Coagulation Factor XIa: independence of factor XIa subunits in factor IX activation.
18186617 2008 Functional role of residue 193 (chymotrypsin numbering) in serine proteases: influence of side chain length and beta-branching on the catalytic activity of blood coagulation factor XIa.
18024374 2007 Characterization of seven novel mutations causing factor XI deficiency.
18020374 2007 A catalytic domain exosite (Cys527-Cys542) in factor XIa mediates binding to a site on activated platelets.
18005151 2008 Seven novel point mutations in the F11 gene in Iranian FXI-deficient patients.
17768109 2007 Factor XI/ADAMTS13 complexes are quantitatively insignificant in human plasma.
17652512 2007 Feedback activation of factor XI by thrombin does not occur in plasma.
17597996 2007 Factor XI in haemostasis and thrombosis: past, present and future.
17581330 2007 A novel mutation (Gln433Glu) in exon 12 combined with the G insertion in exon 13 causes severe factor XI deficiency in Japanese patients.
17549289 2007 Characterisation of five factor XI mutations.
17284699 2007 Association of genetic variations with nonfatal venous thrombosis in postmenopausal women.
17257616 2007 Dimer dissociation and unfolding mechanism of coagulation factor XI apple 4 domain: spectroscopic and mutational analysis.
17229051 2007 A cross-reactive material positive variant of coagulation factor XI (FXIP520L) with a catalytic defect.
16878977 2006 Contributions of basic amino acids in the autolysis loop of factor XIa to serpin specificity.
16835901 2006 Spectrum of factor XI (F11) mutations in the UK population--116 index cases and 140 mutations.
16613788 2006 Study of association between hypertensive disorders of pregnancy and the human coagulation factor XI gene.
16607084 2006 Identification of five novel mutations in the factor XI gene (F11) of patients with factor XI deficiency.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16330457 2005 A type II mutation (Glu117stop), induction of allele-specific mRNA degradation and factor XI deficiency.
16204896 2005 Mutation of surface residues to promote crystallization of activated factor XI as a complex with benzamidine: an essential step for the iterative structure-based design of factor XI inhibitors.
16085935 2005 Structural and mutational analyses of the molecular interactions between the catalytic domain of factor XIa and the Kunitz protease inhibitor domain of protease nexin 2.
16079124 2005 Factor XI deficiency: identification of six novel missense mutations (P23L, P69T, C92G, E243D, W497C and E547K).
16042419 2005 Factor XIa dimer in the activation of factor IX.
15996948 2005 Factor XI deficiency with a novel homozygous mutation Trp599Arg near the C-terminal region.
15953011 2005 Genetic analysis in FXI deficiency: six novel mutations and the use of a polymerase chain reaction-based test to define a whole gene deletion.
15870541 2005 Coagulation factor XI: a database of mutations and polymorphisms associated with factor XI deficiency.
15842381 2005 Novel missense mutations in two patients with factor XI deficiency (Val271Leu and Tyr351Ser) and one patient with combined factor XI and factor IX deficiency (Phe349Val).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15634276 2005 Structural interpretation of 42 mutations causing factor XI deficiency using homology modeling.
15545266 2005 Crystal structures of the FXIa catalytic domain in complex with ecotin mutants reveal substrate-like interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456490 2004 Severe factor XI deficiency caused by a Gly555 to Glu mutation (factor XI-Glu555): a cross-reactive material positive variant defective in factor IX activation.
15456480 2004 Real-time quantitative PCR analysis of factor XI mRNA variants in human platelets.
15456479 2004 Do platelets synthesize factor XI?
15375170 2004 Factor XI interacts with the leucine-rich repeats of glycoprotein Ibalpha on the activated platelet.
15317813 2004 Identification of a binding site for glycoprotein Ibalpha in the Apple 3 domain of factor XI.
15226185 2004 An Alu-mediated 31.5-kb deletion as the cause of factor XI deficiency in 2 unrelated patients.
15182578 2004 [FXI gene mutations in two pedigrees of congenital clotting factor XI deficiency].
15180874 2004 Severe factor XI deficiency caused by compound heterozygosity.
15090552 2004 Structural role of Gly(193) in serine proteases: investigations of a G555E (GLY193 in chymotrypsin) mutant of blood coagulation factor XI.
15072993 2004 Factor XI-dependent reciprocal thrombin generation consolidates blood coagulation when tissue factor is not available.
15026311 2004 Dominant factor XI deficiency caused by mutations in the factor XI catalytic domain.
14717969 2004 Molecular basis of severe factor XI deficiency in seven families from the west of France. Seven novel mutations, including an ancient Q88X mutation.
14629467 2003 Factor XI apple domains and protein dimerization.
14521595 2003 Thrombophilic families with inheritably associated high levels of coagulation factors VIII, IX and XI.
14521591 2003 The function of factor XI in tissue factor-initiated thrombin generation.
12944405 2003 The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.
12871398 2003 Inherited factor XI deficiency confers no protection against acute myocardial infarction.
12496253 2003 The factor IX gamma-carboxyglutamic acid (Gla) domain is involved in interactions between factor IX and factor XIa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372819 2002 Unusual proteolytic activation of pro-hepatocyte growth factor by plasma kallikrein and coagulation factor XIa.
12167623 2002 The interaction of factor XIa with activated platelets but not endothelial cells promotes the activation of factor IX in the consolidation phase of blood coagulation.
12029092 2002 Activated platelets but not endothelial cells participate in the initiation of the consolidation phase of blood coagulation.
11895778 2002 Factor XI deficiency in French Basques is caused predominantly by an ancestral Cys38Arg mutation in the factor XI gene.
11891231 2002 Cloning and characterization of the human factor XI gene promoter: transcription factor hepatocyte nuclear factor 4alpha (HNF-4alpha ) is required for hepatocyte-specific expression of factor XI.
11412111 2001 Localization of a heparin binding site in the catalytic domain of factor XIa.
10962009 2000 Activation of hepatocyte growth factor and urokinase/plasminogen activator by matriptase, an epithelial membrane serine protease.
10823824 2000 The role of high molecular weight kininogen and prothrombin as cofactors in the binding of factor XI A3 domain to the platelet surface.
10606881 1999 Heterozygous factor XI deficiency associated with three novel mutations.
10552949 1999 Factor XI messenger RNA in human platelets.
10494760 1999 The levels of factor XIIa generated in human plasma on an electronegative surface are insensitive to wide variation in the concentration of FXII, prekallikrein, high molecular weight kininogen or FXI.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10027710 1999 Identification of a novel mutation in a non-Jewish factor XI deficient kindred.
9787168 1998 Identification of mutations and polymorphisms in the factor XI genes of an African American family by dideoxyfingerprinting.
9593722 1998 Molecular cloning of platelet factor XI, an alternative splicing product of the plasma factor XI gene.
9401068 1997 Severe factor XI deficiency in an Arab family associated with a novel mutation in exon 11.
9242536 1997 A comparison of murine and human factor XI.
8703832 1996 Clearance of human factor XIa-inhibitor complexes in rats.
8555184 1996 Inhibitory properties of a novel human Kunitz-type protease inhibitor homologous to tissue factor pathway inhibitor.
7888672 1995 Six point mutations that cause factor XI deficiency.
7669672 1995 Identification of two novel mutations in non-Jewish factor XI deficiency.
7044446 1982 Factor XI antigen and activity in human platelets.
6626744 1983 Immunologic studies of human coagulation factor XI and its complex with high molecular weight kininogen.
3936495 1985 Stoichiometry of binding of high molecular weight kininogen to factor XI/XIa.
3636155 1986 Amino acid sequence of human factor XI, a blood coagulation factor with four tandem repeats that are highly homologous with plasma prekallikrein.
2844223 1988 Inactivation of human plasma kallikrein and factor XIa by protein C inhibitor.
2827746 1987 Organization of the gene for human factor XI.
2813350 1989 Factor XI (plasma thromboplastin antecedent) deficiency in Ashkenazi Jews is a bleeding disorder that can result from three types of point mutations.
2551064 1989 Purification and characterization of plasma protein C inhibitor.
2052060 1991 Factor XI deficiency in Ashkenazi Jews in Israel.
2019570 1991 Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.
1998667 1991 Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.
1952475 1991 Factor XI deficiency acquired by liver transplantation.
1762944 1991 Dinucleotide repeat polymorphism in the human coagulation factor XI gene, intron B (F11), detected using the polymerase chain reaction.
1673289 1991 A detailed multipoint map of human chromosome 4 provides evidence for linkage heterogeneity and position-specific recombination rates.
1652157 1991 Factor XI activation in a revised model of blood coagulation.
1547342 1992 Expression of human blood coagulation factor XI: characterization of the defect in factor XI type III deficiency.
89876 1979 Hageman-factor-dependent fibrinolysis: generation of fibrinolytic activity by the interaction of human activated factor XI and plasminogen.