Property Summary

NCBI Gene PubMed Count 282
PubMed Score 1386.92
PubTator Score 3139.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P00742 Q14340
Symbols FX
FXA

Gene

F10

PDB

2GD4   5JQY   5JTC   5JZ8   5JZU   5JZZ   1NL8   1C5M   1EZQ   1F0R   1F0S   1FAX   1FJS   1FXY   1G2L   1G2M   1HCG   1IOE   1IQE   1IQF   1IQG   1IQH   1IQI   1IQJ   1IQK   1IQL   1IQM   1IQN   1KSN   1LPG   1LPK   1LPZ   1LQD   1MQ5   1MQ6   1MSX   1NFU   1NFW   1NFX   1NFY   1P0S   1V3X   1WU1   1XKA   1XKB   1Z6E   2BMG   2BOH   2BOK   2BQ6   2BQ7   2BQW   2CJI   2D1J   2EI6   2EI7   2EI8   2FZZ   2G00   2H9E   2J2U   2J34   2J38   2J4I   2J94   2J95   2JKH   2P16   2P3F   2P3T   2P3U   2P93   2P94   2P95   2PHB   2PR3   2Q1J   2RA0   2UWL   2UWO   2UWP   2VH0   2VH6   2VVC   2VVU   2VVV   2VWL   2VWM   2VWN   2VWO   2W26   2W3I   2W3K   2WYG   2WYJ   2XBV   2XBW   2XBX   2XBY   2XC0   2XC4   2XC5   2Y5F   2Y5G   2Y5H   2Y7X   2Y7Z   2Y80   2Y81   2Y82   3CEN   3CS7   3ENS   3FFG   3HPT   3IIT   3K9X   3KL6   3KQB   3KQC   3KQD   3KQE   3LIW   3M36   3M37   3Q3K   3SW2   3TK5   3TK6   4A7I   4BTI   4BTT   4BTU   4Y6D   4Y71   4Y76   4Y79   4Y7A   4Y7B   4ZH8   4ZHA   5K0H  

 OMIM Phenotype (1)

Protein-protein Interaction (1)

AA Sequence

MGRPLHLVLLSASLAGLLLLGESLFIRREQANNILARVTRANSFLEEMKKGHLERECMEETCSYEEAREV      1 - 70
FEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFC     71 - 140
HEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDP    141 - 210
TENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQ    211 - 280
AKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAE    281 - 350
STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDSG    351 - 420
GPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK      421 - 488
//