Property Summary

NCBI Gene PubMed Count 268
PubMed Score 1316.41
PubTator Score 3139.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P00742 Q14340
Symbols FX
FXA

Gene

F10

PDB

2GD4   1NL8   1C5M   1EZQ   1F0R   1F0S   1FAX   1FJS   1FXY   1G2L   1G2M   1HCG   1IOE   1IQE   1IQF   1IQG   1IQH   1IQI   1IQJ   1IQK   1IQL   1IQM   1IQN   1KSN   1LPG   1LPK   1LPZ   1LQD   1MQ5   1MQ6   1MSX   1NFU   1NFW   1NFX   1NFY   1P0S   1V3X   1WU1   1XKA   1XKB   1Z6E   2BMG   2BOH   2BOK   2BQ6   2BQ7   2BQW   2CJI   2D1J   2EI6   2EI7   2EI8   2FZZ   2G00   2H9E   2J2U   2J34   2J38   2J4I   2J94   2J95   2JKH   2P16   2P3F   2P3T   2P3U   2P93   2P94   2P95   2PHB   2PR3   2Q1J   2RA0   2UWL   2UWO   2UWP   2VH0   2VH6   2VVC   2VVU   2VVV   2VWL   2VWM   2VWN   2VWO   2W26   2W3I   2W3K   2WYG   2WYJ   2XBV   2XBW   2XBX   2XBY   2XC0   2XC4   2XC5   2Y5F   2Y5G   2Y5H   2Y7X   2Y7Z   2Y80   2Y81   2Y82   3CEN   3CS7   3ENS   3FFG   3HPT   3IIT   3K9X   3KL6   3KQB   3KQC   3KQD   3KQE   3LIW   3M36   3M37   3Q3K   3SW2   3TK5   3TK6   4A7I   4BTI   4BTT   4BTU   4Y6D   4Y71   4Y76   4Y79   4Y7A   4Y7B   4ZH8   4ZHA   5K0H  

  Ortholog (12)

 GWAS Trait (1)

Gene RIF (216)

PMID Text
27264807 homozygous mutation g.27881G>A(p.Val298Met) of the F10 gene has been identified, which probably accounts for the low FX concentrations in this pedigree
26708756 The Ala275Val substitution is a pathogenic mutation that causes the inherited FX deficiency.
26175037 Various acylcarnitines inhibited factor Xa-initiated clotting.
26120939 Establish FXa as a potentially important asthma mediator, stimulating airway smooth muscle function through actions requiring PAR-1 and annexin A2 and involving integrin coactivation.
26083275 FX carboxyl-terminal region downstream of residue K467 is not essential for secretion and provides a modest contribution to pro-coagulant properties.
26058941 In our medical center, rivaroxaban concentrations could be assessed by a rapid chromogenic method.
26012870 Asymmetric processing of mutant factor X Arg386Cys reveals differences between intrinsic and extrinsic pathway activation.
25803519 Several members of a family had a c.112 G>C mutation in exon 2 of the F10 gene. Although in-silico analysis predicts this is a benign mutation, this family suggests that the amino acid substitution affects the properties of the factor X protein.
25743687 Factor Xa plasma levels were higher in shift work nurses compared to daytime working nurses.
25688138 Letter/Case Report: demonstrate the clinical utility of monitoring rivaroxaban levels through measurements of anti-Xa activity.
More...

AA Sequence

MGRPLHLVLLSASLAGLLLLGESLFIRREQANNILARVTRANSFLEEMKKGHLERECMEETCSYEEAREV      1 - 70
FEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFC     71 - 140
HEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDP    141 - 210
TENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQ    211 - 280
AKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAE    281 - 350
STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDSG    351 - 420
GPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK      421 - 488
//

Text Mined References (285)

PMID Year Title
27264807 2016 [Homozygous missense mutation p.Val298Met of F10 gene causing hereditary coagulation factor X deficiency in a Chinese pedigree].
26708756 2016 A novel Ala275Val mutation in factor X gene influences its structural compatibility and impairs intracellular trafficking and coagulant activity.
26222694 2015 Frequency of the p.Gly262Asp mutation in congenital Factor X deficiency.
26175037 2015 Acylcarnitines are anticoagulants that inhibit factor Xa and are reduced in venous thrombosis, based on metabolomics data.
26120939 2016 The Coagulant Factor Xa Induces Protease-Activated Receptor-1 and Annexin A2-Dependent Airway Smooth Muscle Cytokine Production and Cell Proliferation.
26083275 2015 The carboxyl-terminal region is NOT essential for secreted and functional levels of coagulation factor X.
26058941 2015 Is anti-factor Xa chromogenic assay for Rivaroxaban appropriate in clinical practice? Advantages and comparative drawbacks.
26012870 2015 Asymmetric processing of mutant factor X Arg386Cys reveals differences between intrinsic and extrinsic pathway activation.
25803519 2015 Factor X deficiency associated with compound heterozygosity involving a novel missense mutation at codon 38 from Val (GTC) to Leu (CTC) in exon 2.
25743687 2015 Heparanase procoagulant activity, factor Xa, and plasminogen activator inhibitor 1 are increased in shift work female nurses.
More...