Property Summary

NCBI Gene PubMed Count 386
PubMed Score 942.22
PubTator Score 511.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (36)

Disease log2 FC p
Rheumatoid Arthritis 1.600 2.3e-02
gastric cancer -1.400 7.4e-05
pancreatic cancer 1.400 3.0e-06
urothelial carcinoma -1.100 5.1e-03
posterior fossa group B ependymoma 2.300 1.2e-07
oligodendroglioma 1.700 1.7e-02
psoriasis 1.800 8.8e-04
osteosarcoma 1.604 1.6e-05
group 3 medulloblastoma 1.900 2.1e-03
atypical teratoid / rhabdoid tumor 2.200 3.2e-05
glioblastoma 1.400 1.0e-02
Duchenne muscular dystrophy 1.091 4.2e-07
Becker muscular dystrophy 1.200 7.1e-05
juvenile dermatomyositis 1.328 5.4e-09
Amyotrophic Lateral Sclerosis 1.915 4.4e-08
acute quadriplegic myopathy 3.242 7.1e-12
tuberculosis -1.100 2.7e-03
pancreatic ductal adenocarcinoma liver m... 2.116 1.4e-02
Common variable immunodeficiency 1.199 4.8e-02
intraductal papillary-mucinous adenoma (... 1.800 1.4e-02
intraductal papillary-mucinous carcinoma... 1.600 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.8e-02
lung cancer -3.700 8.3e-07
sarcoidosis -1.100 4.3e-02
breast carcinoma 1.200 1.7e-04
diabetes mellitus -1.700 1.6e-02
Breast cancer 2.400 2.6e-02
interstitial cystitis -1.800 2.6e-05
pancreatic carcinoma -1.300 1.0e-04
aldosterone-producing adenoma -2.005 3.6e-02
Polycystic Ovary Syndrome -1.169 2.6e-02
ductal carcinoma in situ 1.900 1.9e-03
invasive ductal carcinoma 2.100 6.2e-04
ovarian cancer -4.300 8.8e-15
pituitary cancer -2.600 4.8e-06
Down syndrome 1.100 1.5e-03

Protein-protein Interaction (4)

Gene RIF (306)

PMID Text
26927385 Data show that both Ezrin and SIX1 proteins are highly expressed in alpha fetoprotein-negative hepatocellular carcinoma (HCC) and significantly related with the TNM stage.
26555866 Phospho-Ezrin/Radixin/Moesin (ERM) inhibit cell adhesion, and therefore, dephosphorylation of ERM proteins is essential for cell adhesion.Phospho-ERM induce formation and/or maintenance of spherical cell shape.
26419932 it was found that expression of miR-96 was negatively correlated with the metastatic ability of renal cell carcinoma, and that downregulation of miR-96 could suppress the invasion of renal cancer cell via downregulation of Ezrin expression.
26360636 HIV-1 MA interacts with EZR
26360636 siRNA knockdown of EZR enhances HIV-1 replication; HIV-1 replication is restricted by EZR
26358752 Data indicate that a quinoline-based small molecule, NSC305787, directly binds to ezrin and inhibits its functions.
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
26212029 Activation of liver PKCs during cholestasis leads to Ezrin Thr567 phosphorylation resulting in MRP2 internalization and degradation where ubiquitin ligase E3 GP78 is involved.
26209696 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 ezrin controls the translation of mRNAs preferentially with a structured 5' untranslated region, at least in part, by sustaining the protein level of DDX3 and/or regulating its function.
26135398 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness
26115722 High EZR expression is associated with bone metastasis in renal cell carcinoma.
26042733 These findings are important in understanding the interrelation and dynamics of a CHP1-ezrin-NHE3 regulatory complex.
26032400 Suggest a role for ezrin in advanced glycation end product-induced podocyte damage.
26026587 This is the first study in the literature showing that neuropilin-2 and ezrin are related with prognosis in patients with advanced renal cell carcinoma.
26010871 death receptor pro-apoptotic signalling regulation by ezrin can occur downstream of the death receptor-induced apoptosis Signalling in colon cancer cells.
25955302 The combined expression of ezrin(high) and E-cad(low) or ezrin(high) and ezrin(c) was more associated with lymph node metastasis and poor prognosis. I
25952930 Data shows that show that ezrin proteins are activated in malignant pleural mesothelioma (MPM) and has a role in cell proliferation and migration of MPM cells.
25929323 Ezrin, CD44, and VEGF are over-expressed in GCTB tissue and its adjacent noncancerous tissue samples and may play an important role in the occurrence, invasion, metastasis, and recurrence of GCTB.
25913012 association of ezrin with the actin cytoskeleton and phosphorylation on Thr567 are required, but not sufficient, for PKA and EPAC1 to synergistically promote cell spreading following elevations in intracellular cAMP.
25866790 Anticancer effects of ouabain in A549 cells appear to be related to its ability to regulate and inactivate Src-to-ezrin signaling, and proteins involved in focal adhesion such as Src, FAK, and p130CAS axis are proposed here.
25854173 Our study supports the view that the miR-144 may regulate Ezrin protein expression by inhibiting the invasion and metastasis of osteosarcoma cells.
25809479 Interleukin-1beta has a role in reduction of CD44 Ser-325 phosphorylation in human epidermal keratinocytes that promotes CD44 homomeric complexes, binding to ezrin, and extended, monocyte-adhesive hyaluronan coats
25613038 Our findings have important potential implications demonstrating that together with clinical prognostic factors such as radiotherapy and age, CXCR4 and IGF-1R negatively influences survival in patients with localized SS.
25591774 Ezrin/Sec3 complexes are essential for MUC5AC secretion in NE-stimulated airway epithelial cells and that PIP2 is of critical importance in the formation of these complexes.
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
25554515 ezrin appears to participate in recruiting IQGAP1 to the cell cortex thereby establishing a close connection between membrane-F-actin contacts and actin regulators that can be assembled by IQGAP1.
25544963 ezrin expression could be a promising marker in predicting the clinical outcome of patients with osteosarcoma.
25504542 An autosomal recessively inherited loss-of-function ezrin mutation causes reduced Ras activity and profound intellectual disability.
25445504 Ezrin protein overexpression is associated with pancreatic ductal adenocarcinomas.
25400809 Increased expression of endogenous mature miR-199a might prevent the growth and migration of human cutaneous squamous cell carcinoma via decreasing the expression of CD44 and regulating the interaction between CD44 and Ezrin.
25378401 The seven-transmembrane domain of NGX6a was found to be the critical region for the degradation of NGX6a, and the amino terminus of ezrin is required for the induction of NGX6a degradation.
25337200 Demonstrate that miR-183 acts as a tumor suppressor in gastric cancer, partially at least via regulation of Ezrin.
25304618 High Ezrin expression is asasociated with lung adenocarcinoma.
25299115 Ezrin and moesin expression is related to LSCC invasion and metastasis, and may be important molecular markers for predicting prognosis and therapeutic targets in LSCC patients
25286001 Ezrin, radixin and moesin are unlikely targets for autoantibodies in demyelinating neuropathies.
25251993 inhibition of miR-184 decreased EZR-bound LAMP-1 protein levels and affected phagocytic activity in ARPE19 cells
25231728 High expression of ezrin in human breast tumors significantly correlated with elevated Src expression and the presence of lymphovascular invasion.
25126570 These analyses based on PPI network have greatly expanded our comprehension of the mRNA expression profile of Ezrin knockdown for future examination of the roles and mechanisms of Ezrin.
25087457 This is the first report of extracellular ERM proteins in human and experimental models of traumatic brain injury
25055875 MicroRNA-204 is a direct negative regulator of ezrin gene expression in glioma.
25051016 Results suggest that ezrin is required for epithelial mesenchymal transition(EMT)-induced by TGF-beta1. The interaction of ezrin and PODXL may be important in regulating TGF-beta1-induced EMT.
24924175 Ezrin appears to allow metastatic cells to overcome a number of stresses experienced during the metastatic cascade. (Review)
24885195 The results from this study validate previous findings of reduced membranous ezrin expression in urothelial bladder cancer being associated with unfavourable clinicopathological characteristics and an impaired survival.
24788249 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKCepsilon-dependent manner.
24760896 HIV-1 MA interacts with EZR
24760896 siRNA knockdown of EZR enhances HIV-1 replication; HIV-1 replication is restricted by EZR
24728215 Study demonstrates that the expression of phosphorylated ezrin proteins is related to the clinical and pathological features of pancreatic cancer.
24726496 findings suggest that ezrin may play a role in the development of the renal complication in diabetes by regulating transport of glucose and organization of the actin cytoskeleton in podocytes.
24662291 ALCAM stably interacts with actin by binding to syntenin-1 and ezrin.
24629131 Data shows that Ezrin and phosphorylated Ezrin were upregulated in non small cell lung carcinoma and correlated with the poor differentiation and late clinical stage suggesting there utilization as a novel prognostic biomarker of NSCLC.
24614149 expression in the osteosarcoma cell lines modulates the Rac1 expression
24599913 Increased phosphorylation of ezrin is associated with the migration and invasion of fibroblast-like synoviocytes from patients with rheumatoid arthritis.
24500715 These results are in line with in vivo experiments demonstrating that an increase in PIP2 concentration recruits more ezrin to the apical plasma membrane of polarized cells and significantly increases the membrane tension
24462708 The phosphorylated ezrin T567 is regulated by the IGF1R signaling pathway and this activation enhances cell survival in CRC cells by modulating XIAP and survivin.
24413175 Part of the machinery for ezrin activation depends on recycling endosomes controlled by myosin Vb and Rab11a.
24398676 1) NHE3 basal activity is regulated by a signaling complex that is controlled by sequential effects of two kinases, Akt and GSK-3, which act on a Ser cluster in the same NHE3 C-terminal domain that binds ezrin
24352761 High Expressions of Ezrin is associated with osteosarcoma.
24346284 Our data suggest that Akt/Ezrin Tyr353/NF-kappaB pathway regulates EGF-induced EMT and metastasis inTSCC, and Ezrin may serve as a therapeutic target to reverse EMT in tongue cancers and prevent TSCC progression
24303922 Expression levels significantly higher in melanomas than in nevus pigmentosus
24182314 Aberrant localization and overexpression of ezrin might be an independent effective biomarker for prognostic evaluation of cervical cancers.
24151071 Ezrin can exist in three different conformational states, and different ligands "perceive" ezrin conformational states differently.
24129929 Data indicate that cytoplasmatic ezrin expression increases from benign to malignant breast tumour development.
24086451 Ezrin phosphorylated at T567 is highly overexpressed in the membrane of human breast tumors and positively associated with invasive growth and HER2 overexpression.
24014052 Therefore, the findings from this systematic review suggest that ezrin expression is an effective biomarker of prognosis in patients with osteosarcoma.
23959472 cytovillin expression is obviously associated with lower overall survival rate in patients with osteosarcoma.
23900701 Ezrin and CD44 co-expression was highly expressed in neoplastic stem cells and may be a potential biomarker for initiation, progression and differentiation of breast cancer tumors.
23894313 Our findings suggested that Ezrin protein expression might be a factor for a poor prognosis in patients with solid tumor.
23882136 Genetic variations and single nucleotide polymorphisms in the gene EZR possibly contribute to the development of age-related cataracts in the Chinese population.
23803027 Ezrin is not associated with the histologic response to chemotherapy in patients with osteosarcoma, whereas Ezrin positivity was associated with a lower 2-year survival rate regarding risk of death at 2 years.
23766411 miR-22 is down-regulated in hepatocellular carcinoma, and its expression is associated with the differentiation, metastasis and disease progression. Ezrin is a potential regulatory protein of miR-22.
23752190 this study identifies a novel Dsg3-mediated c-Jun/AP-1 regulatory mechanism and PKC-dependent Ezrin phosphorylation that could be responsible for Dsg3-associated cancer metastasis.
23708420 we identified ezrin as a potential biomarker to evaluate the tumor progression and prognosis of colorectal adenocarcinoma (CRA).
23703860 important role of ezrin-moesin-radixin proteins during HCV infection at the postentry level and highlight possible novel targets for HCV treatment.
23629860 Data indicate that EGF-induced cellular invasion required sphingosine-1-phosphate (S1P)-mediated activation of sphingosine-1-phosphate 2 receptor (S1PR2) and ezrin phosphorylation.
23614908 serine 249 of ezrin can play important roles in the regulation of the complex formation and membrane localization of NaPi-IIa.
23465281 ezrin has different roles in the development of Intraductal papillary mucinous neoplasms and pancreatic intraepithelial neoplasia
23435957 Ezrin plays an important role in the tumorigenicity and metastasis of lung cancer cells.
23422152 The overexpression of ezrin in the CD44(+) subpopulation of SCC-9 cells might affect the functions of CD44(+) tumor cells, which contribute to the metastatic behavior of malignant oral squamous cell carcinoma.
23420497 The aim of this study was to examine the expression of ERM (ezrin, moesin) and Rho (RhoA, RhoB and Cdc42) proteins in breast cancer (BC) patients.
23394223 Expression in laryngeal squamous cell carcinoma is associated with clinical stage, histological grade, and lymph node metastasis
23326330 Data suggest that P-glycoprotein associate with the F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic leukemia (T-ALL) cells.
23325686 Ezrin and EHD4 appear to be involved in the ability of Nef to increase hiv-1 virus infectivity.
23325686 HIV-1 MA interacts with EZR
23324233 Ezrin expression affects the cellular protrusions/microvilli formation, anchorage-independent growth, cell migration and invasion in the pancreatic cancer cell line Panc-1.
23214316 The high expression of Ezrin and the low expression of E-Cadherin were related to invasion and metastasis in papillary thyroid carcinoma.
23209815 Fascin-1, ezrin and paxillin contribute to the malignant progression and are predictors of clinical prognosis in laryngeal squamous cell carcinoma.
23209304 It was shown that lymphocyte-oriented and STE20 kinase were sufficient to restrict ezrin function to the apical domain. Both kinases were enriched in microvilli and locally activated there.
23185364 Ezrin interacts with the SARS coronavirus Spike protein and restrains infection at the entry stage
23166591 HIV-1 MA interacts with EZR
23116763 Control of adipogenesis by ezrin, radixin and moesin-dependent biomechanics remodeling.
23098471 Ezrin overexpression is associated with pancreatic cancer.
23067217 Enhanced expression of ezrin is associated with the development of cervical neoplasia and cancer.
23039327 The detection of Ezrin expression can be used as the marker for early diagnosis and prognosis of gastric adenocarcinoma.
23031255 Lipid rafts regulate interactions between CD44 and its binding partner ezrin in migrating breast cancer cells.
23017497 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
22967445 Ezrin, E-cadherin and CD44V6 play an important role in the regulation of growth and meastasis of lung cancer.
22964850 significant role for the multiprotein complex CFTR-NHERF1-ezrin-actin in maintaining tight junction organisation and barrier function
22927432 Structural studies of the activated ezrin bound to phosphatidylinositol 4,5-bisphosphate and to F-actin.
22922800 Through inhibition of Ezrin expression levels, miR-183 is significantly involved in cell migration and invasion of osteosarcoma.
22898813 C. neoformans activates RhoGTPases and subsequently FAK, ezrin, and PKCalpha to promote their traversal across the HBMEC monolayer, which is the critical step for cryptococcal brain infection and development of meningitis.
22891241 Ezrin/radixin/moesin are required for the purinergic P2X7 receptor (P2X7R)-dependent processing of the amyloid precursor protein.
22869145 Results suggest L1-mediated signaling by the L1-ezrin-NF-kappaB pathway, that induces IGFBP-2 expression, has an important role in colorectal cancer progression.
22843905 panel consisting of moderate/strong expression of CA IX, positive HIF-1alpha expression and negative/weak GLUT-1 expression in operative samples and negative/weak ezrin expression in biopsies was associated with 47.5-fold risk of death from this disease
22685202 Ano1, ezrin, and moesin/radixin colocalize apically in salivary gland epithelial cells, and overexpression of moesin and Ano1 in HEK cells alters the subcellular localization of both proteins
22629406 our data reveal a role for ezrin in Met receptor stability and activity through its association with the E3 ubiquitin ligase WWP1. Given the role of Met in cell proliferation and tumorigenesis, ezrin may play a role in tumor progression.
22628548 Data report that NHERF1, a modular PDZ domain scaffolding protein, coordinates the assembly of an obligate ternary complex with Npt2a and the PKA-anchoring protein ezrin to facilitate PTH-responsive cAMP signaling events.
22577345 Our data led to a novel and unifying hypothesis that Ezrin contributes to the efficiency of metastasis through regulation of protein translation
22544491 results indicate the over-expression of ezrin in endometriosis may play a significant role in the migration of endometrial cells of endometriosis, and the RhoC/Rock pathway may provide a promising treatment target
22528947 ezrin expression correlated significantly with lymphatic metastasis and advanced TNM stage.
22476538 Ezrin and BCAR1/p130Cas mediate breast cancer growth as 3-D spheroids
22415480 The cytoplasmic relocalization of ezrin may therefore represent a novel marker for large malignant tumor size, reflecting the unique biology of locally advanced breast cancer (LABC) .
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22291017 role of CCM3 and ezrin/radixin/moesin family of proteins in cell's response to oxidative stress
22234584 Increased expression of ezrin may represent a marker of aggressive biological behaviour in rectal cancer.
22230495 In CNE2 cells, the DNA sequence upstream of the ezrin promoter could exhibit transcriptional activation and enhancement, in a position- and orientation-dependent manner.
22228328 Report ezrin expression in chordomas in regards to prognosis.
22199327 Carbonic anhydrase IX, hypoxia-inducible factor-1alpha, ezrin and glucose transporter-1 have roles in disease outcome in rectal cancer
22192140 Ezrin is a prominent protein in the cycling endometrium.
22177047 The up-regulation of Ezrin and Moesin and the down-regulation of E-Cadherin were associated with the invasion and metastasis of papillary thyroid carcinoma.
22172411 The expression of ezrin, HGF and/or c-met might be closely related to the carcinogenesis, progression, clinical biological behaviors and prognosis of gallbladder adenocarcinoma.
22137559 high level expression contributes to non--small-cell lung cancer progression
22132106 The ERM (ezrin, radixin, moesin) proteins are novel scaffolds at the level of SOS activity control, which is relevant for both normal Ras function and dysfunction known to occur in several human cancers.
21971708 gastrointestinal stromal tumor cases exhibiting expression of phosphorylated Thr567 in the ezrin protein were associated with immunoactivities of KIT and merlin expression
21915031 We sought to determine if ezrin, KBA.62, p-Akt, CD166, and nestin, may be helpful in distinguishing melanoma from nevi and atypical melanocytic lesions
21909685 Ezrin expression is associated with distinguish schwannoma from fibroblastic meningioma.
21899702 Ezrin is required for the apical cell surface localization of MRP2 during Salmonella typhimurium infection.
21878630 N,N'-dinitrosopiperazine-mediated ezrin protein phosphorylation via activation of Rho kinase and protein kinase C is involved in metastasis of nasopharyngeal carcinoma 6-10B cells.
21874375 Data show that lesser differentiated tumors had elevated expression of Six1 and Ezrin mRNA and protein.
21873785 Berberine inhibits nasopharyngeal carcinoma cell invasion through inhibiting phospho-Ezrin expression and filopodia formation.
21868260 ezrin and paxillin may have roles in aggressive tumor features and invasiveness in urothelial bladder tumors
21864676 the ezrin, radixin and moesin proteins differentially modulate sphingosine 1 phosphate-induced alterations in lung endoethlial cell cytoskeleton and permeability
21849257 Study demonstrated the probable tumorigenic role of ezrin in epithelial skin tumor formation.
21837648 results indicate that ezrin influences the expression of P-gp at the translational level, whereas radixin is involved in membrane localization of P-gp in HepG2 cells
21818323 The effects of 17beta-estradiol (E2) on the activation of ezrin and its role in estrogen-dependent breast cancer cell movement, was investigated.
21789023 Elevated expression of ezrin was associated with lymph node metastasis and poor prognosis in patients with invasive ductal carcinoma.
21780101 ezrin exerts a key role in multidrug resistance of human osteosarcoma cells through a Pgp-ezrin-actin connection that is instrumental for the permanence of Pgp into plasma membrane lipid rafts.
21751142 The results demonstrated that both Ezrin and c-Met overexpression were related to the occurrence and progression of gastric carcinoma
21717114 Ezrin protein levels were up-regulated in gastric cancer lesions compared with adjacent noncancerous tissues.
21712385 Dbl is regulated by hamartin through association with ezrin.
21672629 Ezrin promotes PTH1R mediated signaling via phospholipase and PIP2 depletion impedes receptor cell surface expression in HEK293 cells.
21659656 Ezrin, radixin, and moesin are phosphorylated in response to 2-methoxyestradiol and modulate endothelial hyperpermeability.
21628504 data suggest that more than 1 region upstream of VIL2 promoter participated in VIL2 transcription, and VIL2 -1297/-1186, probably as a key transcriptional regulatory region, regulated VIL2 transcription in company with other potential regulatory regions.
21625943 Increased ezrin expression was significantly related to higher lymph nodal metastatic rate
21585339 When these regions were separately located upstream of the VIL2 or SV40 promoters, only the -1297/-1186 considerably enhanced the activity of these promoters.
21550270 The increased expression of Ezrin and its partners, CD44v6, iNOS, and Ki-67, in SACC correlated with histologic patterns, may play a role in distant metastasis, and might indicate poor clinical outcome.
21540295 a novel function for Ezrin in Rap1-induced cell spreading and evidence of a non-redundant role of an ERM family member
21465252 Higher expression of the Ezrin correlates with tumor aggressiveness and worse prognosis for colorectal cancer.
21444753 Ezrin-rich uropod-like structure of polarised A375 cells is necessary for cell invasion.
21416469 High ezrin expression is associated with esophageal squamous cell carcinoma.
21412073 Our results suggest that S100P-ezrin signaling has different roles of carcinogenesis of perihilar ICC and an aggressive course of peripheral intrahepatic cholangiocarcinoma.
21363921 our findings implicate Rho kinase-ezrin signaling in hepatocellular carcinoma cell invasion
21352885 ezrin, radixin and moesin play similar roles in the tumor cell metastatic potential and their roles of upregulating the expression of E-cadherin may be important in tumor progression
21340023 Actin-EGFP and ezrin-EGFP accumulated below pilus-coated beads when force was applied.
21282970 ezrin may play a key role in the migration and invasion of gastric cancer cells.
21278261 Dysregulation of the ezrin/radixin/moesin-RAGE complex might be an important step in rearrangement of the actin cytoskeleton during proinflammatory cytokine-induced epithelial-mesenchymal transition of human alveolar epithelial cells.
21278069 This study provides the novel evidence that increased phosphorylation of Ezrin/radixin/moesin proteins may contribute to proliferation of rheumatoid fibroblast-like synoviocytes.
21190723 Preoperative radiotherapy modulates ezrin expression and its value as a predictive marker in patients with rectal cancer.
21176563 Increased expressions of miR-183 and miR-22 may both repress the protein level of ezrin, which might inhibit ovarian cancer metastasis.
21171946 Syk recruitment, activation and downstream signaling following HRV infection are dependent on the interaction between the tandem SH2 domains of Syk and the ITAM of ezrin.
20873751 role for PIP the formation of ezrin oligomers
20872967 Data suggest that increased expression of hnRNP A1, Ezrin, tubulin beta-2C and Annexin A1 in SLNMM indicate a significantly elevated early colorectal cancer metastasis.
20871163 A negative correlation is found between Ezrin and E-cadherin expression in nasopharyngeal carcinoma tissues. Ezrin and E-cadherin are closely related to clinical staging and cervical lymph node metastases.
20859706 A change in ezrin expression is an independent positive prognostic factor in non-metastatic osteosarcoma.
20855527 Data suggest that ezrin-radixin-moesin proteins are involved in the spatial regulation of Epac1 and cooperate with cAMP- and Rap-mediated signaling to regulate adhesion to the extracellular matrix.
20811677 These data indicate a potential role for ezrin in the processes of the CCL5-induced breast cancer cell migration, invasiveness and metastasis.
20711218 A network consisting of ezrin, RhoGDI1, RhoA, F-actin and membrane proteins functions to influence the modifications that occur on the membrane of the sperm head during human sperm capacitation.
20701102 Investigation of ezrin reactivity may be beneficial as an additional diagnostic marker in the differential diagnosis of renalcell carcinoma subtypes.
20679347 Results demonstrate a new regulatory mechanism of ezrin-radixin-moesin phosphorylation by sphingolipids with opposing actions of ceramide and sphingosine 1-phosphate.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585869 Ezrin overexpression was significantly associated with myxofibrosarcomas.
20569470 Ezrin might play functional roles in modulating morphology, growth, motility and invasion of pancreatic cancer cells.
20562647 Neither CD44H nor ezrin immunoexpression could predict the prognosis for patients with osteosarcoma in our small sample.
20558337 The data indicated translocation of ezrin towards the cell periphery within more motile cells in comparison with NRK and parental adenocarcinoma cells.
20552365 ezrin immunohistochemical expression does not offer any diagnostic clues in the differential diagnosis of bone tumors
20551903 These results uncover a crucial function for ezrin, Dlg1 and microtubules in the organization of the immune synapse and TCR signal down-regulation.
20501702 Nuclear factor-kappaB signaling and ezrin are essential for L1CAM mediated metastasis of colon cancer cells.
20395446 Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363977 Ezrin could act as an autoantigen of a streptococcal-induced autoimmune response and represents a target of the exaggerated T cell response in psoriasis.
20348881 ezrin expression is associated with more aggressive osteosarcomas and with metastasis.
20335315 CLIC5A colocalizes with ezrin and podocalyxin in podocytes and is required for the development/maintenance of the proper glomerular endothelial cell and podocyte architecture.
20237154 Data show that PDZK1/EBP50/ezrin form a regulated ternary complex in vitro and in vivo.
20193117 The activation of Ezrin and the absence of E-cadherin contribute to the tumorigenesis and metastasis of esophageal squamous cell carcinoma.
20156804 Overexpression of ezrin disables neurofibromatosis type 2 protein in glioblastoma cells.
20128822 Ezrin probably influences the growth and invasiveness of Esophageal squamous cell carcinomas cells, and phosphorylation is only required in metastatic behavior of tumor cells at the leading edge and invasive front.
20036004 Ezrin silencing by miRNA showed that ezrin plays important roles in the polarization and invasive behaviour of MOLT4 cells.
20010876 Data show a key role for ezrin as a mediator of c-Myc-induced tumorigenesis in prostate cancer cells.
19935704 ezrin has a negative role in the recruitment of Fas into signaling complexes in type I T cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890007 Ezrin, radixin, and moesin proteins are physiological substrates of the kinase activity of leucine-rich repeat kinase 2 (LRRK2).
19830727 Data show that stimulation of the NK cell-expressed tetraspanin CD81 induces phosphorylation of ezrin/radixin/moesin proteins and leads to NK cell polarization thereby facilitating NK cell migration toward various chemokines/cytokines.
19799816 Overexpression of Ezrin and iNOS may promote proliferation and malignant transformation of salivary gland pleomorphic adenoma.
19786985 Our findings suggest a novel regulatory mechanism by which ezrin governs NK cell internalization into tumor cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19654214 CD81-induced ezrin tyrosine phosphorylation required activation of spleen tyrosine kinase.
19648886 Ezrin overexpression in gastrointestinal stromal tumors: an independent adverse prognosticator associated with the non-gastric location.
19639585 HIV-1 MA interacts with EZR
19625176 Observational study of gene-disease association. (HuGE Navigator)
19604375 Ezrin over-expression contributes to de-differentiation and invasion of HBV-HCC cell
19597468 Beta4 integrin promotes osteosarcoma metastasis and interacts with ezrin.
19591839 Upon binding to ezrin, NHERF1 undergoes significant conformational changes in the region linking PDZ2 and its CT ezrin-binding domain, as well as in the region linking PDZ1 and PDZ2, involving very long range interactions over 120 A.
19575999 Overexpression of Ezrin in human salivary gland adenoid cystic carcinoma may promote genesis, development and metastasis of tumors.
19556366 CHP1 increases NHE3 abundance and constitutive function in a manner dependent on ezrin phosphorylation.
19550117 Data show that RhoA may regulate the invasion and metastasis of breast cancer cells as an upstream signaling of Ezrin.
19399936 Ezrin expression is higher in colorectal cancer tissues than in normal colorectal mucosa tissues, and the high level of ezrin expression is closely related to the colorectal cancer invasion and metastasis process.
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
19366061 ezrin and metastatic tumor antigen positivity can be additional prognostic markers in osteosarcoma of the jaw.
19331807 The data suggest that Ezrin, but not CD44 and Six1, could be a prognostic factor and a predictor of potential lung metastasis in osteosarcoma.
19255442 These studies identify a new ERM kinase of importance in lymphocytes and confirm the role of ezrin-radixin-moesin phosphorylation in regulating cell shape and motility.
19234486 phosphorylation of ezrin and its recruitment to the cell membrane linked to F-actin and CD44 is a process required for LMP1-stimulated cell motility and invasion of nasopharyngeal carcinoma cells.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165868 ezrin might function in the growth and invasiveness of esophageal squamous cell carcinoma (ESCC) cells through the MAPK and TGF-beta pathways.
19164283 MEK1/2 phosphorylates ERK1/2, which phosphorylates Sp1 and AP-1 that in turn bind to their respective binding sites to regulate the expression of human VIL2 in ESCC cells.
19152423 radixin, moesin and c14orf166, but not ezrin, had significantly higher expression levels in lymph node metastasis (LNM) pancreatic cancers than in non-LNM controls.
19129194 In Vitro and in Vivo Characterization of Molecular Interactions between Calmodulin, Ezrin/Radixin/Moesin, and L-selectin
19124745 No aspects of T cell receptor signaling uniquely require transgenic ezrin or moesin; instead, T cell activation appears to depend on net ezrin, radixin, and moesin (ERM) protein expression, while ezrin and moesin function together.
19088174 Ezrin overexpression is associated with medulloblastoma.
19084535 These observations highlight the importance of ezrin/F-actin function in the development of dynamic membrane/actin structures critical for cell shape and motility, as well as signal transduction.
19080005 Ezrin gene expression is closely related to invasion and metastasis of pancreatic carcinoma.
19066282 HIV-1 MA interacts with EZR
19060919 ezrin is regulated during osteosarcoma metastasis by PKC
19050913 All conventional chondrosarcomas, whatever their grade, were negative for ezrin, while ten of 16 chondroblastic osteosarcomas were positive for ezrin.
18997619 Ezrin expression levels were not discriminative in predicting outcome of synovial sarcoma.
18941185 Phosphorylation of ezrin/moesin by Rho-associated coiled coil-containing protein kinase (ROCK) is involved in the early steps of apoptotic signaling following Fas receptor triggering and regulates apoptosis induction in Jurkat cells.
18926620 Immunohistochemistry analyses revealed that the membrane expression of ezrin is associated with the clinical outcome of patients with T1G3 bladder tumours undergoing bacillus Calmette-Guerin treatment.
18852256 This article provides a mechanism for podosome formation to facilitate pancreatic cancer cell invasiveness: ezrin, at its C-terminal end interacts with cortactin to form podosomes.
18840437 These findings demonstrated a new role and regulatory mechanism of miR-183 in controlling cancer metastasis; Ezrin is a bona fide target of miR-183.
18788632 The strong ezrin protein expression in the infiltrating ductal carcinoma was positively correlated with axillary lymph node metastasis, histological differentiation grade, TNM stage and CD44v6 expression, but negatively correlated with E-cadherin.
18725408 analysis of the Ca2+ -regulated ezrin-S100P interaction and its role in tumor cell migration
18701134 Ezrin may play a role in colorectal cancer progression and that ezrin expression might provide clinically valuable information in predicting the biological behavior of colorectal cancer.
18682798 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18552365 Ezrin is a potential marker for endometrial cell invasion and is associated with the pathogenesis of endometriosis.
18545143 Ezrin expression in hepatic malignant fibrous histiocytoma can provide additional prognostic information and may be a potential target for new adjuvant therapies.
18508927 a specific domain in Fas, topologically and functionally distinct from the death domain, which regulates neuritogenesis via recruitment of ezrin and activation of Rac1
18486367 Ezrin's localization and association with cell specializations indicate that in the vagina ezrin likely modulates vaginal cell-cell interactions
18459457 supports a role of ezrin in progression in human prostate cancers
18425081 Hepatocellular carcinoma with ezrin expression might be at least partly derived from hepatic progenitor cells.
18305045 RNA interference to ezrin increases the virus susceptibility of human TE cells
18295815 the ezrin, radixin, and moesin proteins function as positive regulators of infection by X4-tropic HIV-1
18295815 HIV-1 MA interacts with EZR
18270268 Apically localized phosphorylation by PKCiota is essential for the activation and normal distribution of ezrin at the early stages of intestinal epithelial cell differentiation.
18246799 The expression of ezrin in esophageal squamous cell carcinoma was closely related to lymph node metastasis.
18203644 ezrin peptide (aa 277-299) dose-dependently reversed the inhibitory effect of glycated albumin on ezrin (1-324) phosphorylation in vitro, suggesting that binding of advanced glycation endproducts to ezrin changes the conformation of the latter
18155831 These data indicate that ezrin overexpression positively correlated with metastatic potentials of human breast cancer cells, especially lymphatic system metastasis.
18078820 The identification of Ezrin as a specific and direct cellular substrate of PRL-3, is reported.
18046454 Ezrin/Fes interaction at cell-cell contacts plays an essential role in hepatocyte growth factor-induced cell scattering.
17911601 Ezrin via ERM-binding phosphoprotein 50 (EBP50) is the essential link between cytoskeletal F-actin and a lipid raft-associated multiprotein complex that negatively regulates T cell immune responses.
17886294 pattern of ezrin staining can identify patients with different risks of relapse of non-metastatic osteosarcoma of the extremity
17881735 ezrin allows the local activation of RhoG at the apical pole of epithelial cells by recruiting upstream and downstream regulators of RhoG and that both PLEKHG6 and ezrin are required for efficient macropinocytosis
17825285 Radixin and ezrin play similar roles in the apical membrane localization of ABCC2 (MRP2) and their expression level and subcellular distribution are important factors in the regulation of ABCC2 (MRP2) at the post-transcriptional level.
17786474 Ezrin and alpha-smooth muscle actin are predictive immunohistochemical prognostic markers for patients with an osteosarcoma
17726647 Signals from the extracellular association CD44-ezrin-actin are an important modulator of Fas-mediated apoptosis.
17659733 The low expression of ezrin implicates the loss of adhesion in diffuse carcinomas. overexpression of ezrin in carcinomas with H pylori infection may be a pathway in which H pylori may cause/initiate gastric carcinoma.
17616675 podocalyxin leads to increased in vitro migration and invasion, increased MMP expression, and increased activation of MAPK and PI3K activity in MCF7 and PC3 cells through its ability to form a complex with ezrin
17538024 These data suggest a mechanism whereby precise spatial guanine nucleotide exchange of Cdc42 by Dbl is dependent on functional ERM proteins and is important for directional cell migration.
17525629 Ezrin is de-expressed in endometriosis and endometrioid carcinoma compared with normal uterine epithelium.
17515952 ezrin was differentially expressed in sclerotic hippocampi compared to non-sclerotic ones.
17370041 data support a role for ezrin in the biology of human cancers and the need for additional studies in breast cancer and sarcoma patients that may validate ezrin as a marker of cancer progression and as a potential target for cancer therapy
17370040 identification of PTHrP and ezrin as important regulators of lung cancer bone metastasis offers new mechanistic insights into the metastasis of lung cancer and provides potential targets for the prevention and treatment of lung cancer metastasis
17349711 HIV-1 MA interacts with EZR
17237445 increased CD44, ezrin, radixin, and moesin phosphorylation represents a key molecular abnormality that guides T cell adhesion and migration in SLE patients.
17028919 the action of ezrin in Ewing's sarcoma is dependent on the AKT/mTOR signal transduction cascade, but not MAP Kinase.
16889625 Expression of ExoS in HeLa cells led to a loss of phosphorylation of Ezrin/radixin/moesin proteins that was dependent upon the expression of ADP-ribosyltransferase activity.
16873375 Hormonal regulation of ezrin phosphorylation is required for androgen-induced cell invasion.
16867268 Over-expression of ezrin and cytoskeleton protein gamma-actin are associated with the process of metastasis of hepatocellular carcinoma cells.
16677779 Ezrin appears to play a role in the progression of tumors, such as the metastasis of osteosarcoma.
16648854 the release of ezrin from lipid rafts acts as a critical trigger that regulates lipid raft dynamics during B cell antigen receptor signaling.
16633060 data imply that ezrin is necessary for tumor cell invasion, and the better prognosis of ovarian carcinomas lacking ezrin is probably related to their impaired invasion
16554733 Elevated ezrin expression is a new independent prognostic marker in FIGO stage I endometrioid carcinoma, and thus provides further evidence for an important role of ezrin in tumor progression.
16538541 a change in ezrin localization from the apical membrane to either the complete membrane or to the cytoplasm may have a role in dedifferentiation in invasive breast tumors
16438931 Protein Kinase A-mediated phosphorylation of ezrin is essential and sufficient for the apical localization of WW domain containing oxidoreductase (WWOX) protein as disruption of ezrin-WWOX interaction eliminated the apical localization of WWOX
16352594 Ezrin directly interacts with the alpha1b-adrenergic receptor and plays a role in receptor recycling.
16230228 Ezrin was expressed in the majority of prostate cancers and correlated with adverse prognostic factors
16144921 High expressions of ezrin is associated with development of distant metastasis of soft tissue sarcomas
16129695 ezrin binding activates the second PDZ domain of NHERF to interact with the cytoplasmic tails of CFTR (C-CFTR), so as to form a specific 2:1:1 (C-CFTR)(2).NHERF.ezrin ternary complex
15843435 Ezrin is a novel substrate of GRK2
15835821 Fibronectin and ezrin were upregulated in primary laryngeal carcinoma.
15818415 HIV-1 MA interacts with EZR
15751968 Results strongly support the conformational activation model of ezrin, elucidate the basis for dimer formation, and reveal that a mutant generally considered to be fully activated is not.
15729356 Ezrin accumulates at Listeria protrusions, which plays a role in the Listeria cell-to-cell spread during infection.
15677456 Data show that the integrity of ezrin is essential for parietal cell activation and provide evidence that ezrin interacts with PALS1, an evolutionarily conserved PDZ and SH3 domain-containing protein.
15647376 Src-dependent ezrin phosphorylation has a role in adhesion-mediated events in epithelial cells
15623525 Src phosphorylates ezrin at tyrosine 477
15531580 Akt2-dependent ezrin phosphorylation leads to NHE3 translocation and activation
15252013 Ezrin, radixin and moesin are ADP-ribosylated by Pseudomonas aeruginosa ExoS
15178693 results suggest that ezrin-radixin-moesin proteins are required for microvillar positioning of L-selectin and that this is important both for leukocyte tethering and L-selectin shedding
15149851 All three ERM family members can localise to the nucleus; a specific nuclear localisation sequence, which is conserved and functional in all ERM family members, is identified, implying specific regulated nuclear import.
15096511 ezrin/radixin/moesin proteins are recruited by NHE1 Na+/H+ exchanger and have roles in regulating Akt-dependent cell survival
14981079 pka phosphorylation of merlin serine 518 promotes heterodimerization between merlin and ezrin, an event suggested to convert merlin from a growth-suppressive to a growth-permissive state
14739941 HIV-1 MA interacts with EZR
14704791 results report a significant association between high ezrin expression and poor outcome in pediatric osteosarcoma patients
14704789 Data show that ezrin and the homeodomain-containing transcription factor Six-1 (sine oculis-related homeobox-1 homolog) had essential roles in determining the metastatic fate of rhabdomyosarcoma cells.
14676203 a major role of ezrin is to connect CD95 to actin, thus allowing the CD95 polarization on the cells and the occurrence of the following multiple cascades of the CD95 pathway
12860416 Ezrin N-terminal domain binds to the syndecan-2 cytoplasmic domain with an estimated K(D) of 0.71 microM and without the requirement of other proteins
12800220 The upregulated ezrin expression is one of the important factors that are possibly associated with the invasive phenotype formation in malignantly transformed esophageal epithelial cells (ezrin)
12734202 amino-terminal domains of the ezrin, radixin, and moesin (ERM) proteins bind advanced glycation end products and have a role in diabetes
12711360 Review.CD44 and ezrin and their respective complex have properties suggesting that they may be important in the process of tumour-endothelium interactions, cell migrations, cell adhesion, tumour progression and metastasis.
12626536 Although ezrin is excluded from the inhibitory, i.e., noncytolytic, NK cell immune synapse (IS), it is homogeneously distributed across the IS of activating conjugates.
12560083 evaluated the role of Lck tyrosine kinase, an early effector of T cell activation, in regulation of the membrane-cytoskeleton linker protein ezrin; results identify ezrin as the first cytoskeletal substrate for Lck
12080047 A2BR binds to Ezrin upon agonist stimulation.
10713718 HIV-1 MA interacts with EZR
9213396 HIV-1 MA interacts with EZR
8892894 HIV-1 MA interacts with EZR

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV      1 - 70
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE     71 - 140
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN    141 - 210
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR    281 - 350
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE    351 - 420
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ    421 - 490
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ    491 - 560
GRDKYKTLRQIRQGNTKQRIDEFEAL                                                561 - 586
//

Text Mined References (393)

PMID Year Title
26927385 2016 [Clinicopathological significance of ezrin and SIX1 protein expression in alpha fetoprotein-negative hepatocellular carcinoma].
26555866 2015 Inhibition of cell adhesion by phosphorylated Ezrin/Radixin/Moesin.
26419932 2015 miR-96 suppresses renal cell carcinoma invasion via downregulation of Ezrin expression.
26358752 2015 Identification of Novel Ezrin Inhibitors Targeting Metastatic Osteosarcoma by Screening Open Access Malaria Box.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
26212029 2015 Canalicular membrane MRP2/ABCC2 internalization is determined by Ezrin Thr567 phosphorylation in human obstructive cholestasis.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26149384 2015 Ezrin Binds to DEAD-Box RNA Helicase DDX3 and Regulates Its Function and Protein Level.
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
26115722 2015 Eight proteins play critical roles in RCC with bone metastasis via mitochondrial dysfunction.
26042733 2015 The Na+/H+ Exchanger-3 (NHE3) Activity Requires Ezrin Binding to Phosphoinositide and Its Phosphorylation.
26032400 2016 Ezrin contributes to impaired podocyte migration and adhesion caused by advanced glycation end products.
26026587 2015 The impact of immunohistochemical staining with ezrin-carbonic anhydrase IX and neuropilin-2 on prognosis in patients with metastatic renal cell cancer receiving tyrosine kinase inhibitors.
26010871 2015 Death Receptor-Induced Apoptosis Signalling Regulation by Ezrin Is Cell Type Dependent and Occurs in a DISC-Independent Manner in Colon Cancer Cells.
25955302 2015 Combined expression of ezrin and E-cadherin is associated with lymph node metastasis and poor prognosis in breast cancer.
25952930 2015 The combination of sorafenib and everolimus shows antitumor activity in preclinical models of malignant pleural mesothelioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25929323 2015 Expression of ezrin, CD44, and VEGF in giant cell tumor of bone and its significance.
25913012 2015 Phosphorylation of ezrin on Thr567 is required for the synergistic activation of cell spreading by EPAC1 and protein kinase A in HEK293T cells.
25889165 2015 Plasmodium vivax inhibits erythroid cell growth through altered phosphorylation of the cytoskeletal protein ezrin.
25866790 2015 Inactivation of Src-to-ezrin pathway: a possible mechanism in the ouabain-mediated inhibition of A549 cell migration.
25854173 2015 MicroRNA-144 inhibits the proliferation, apoptosis, invasion, and migration of osteosarcoma cell line F5M2.
25809479 2015 Interleukin-1?-induced Reduction of CD44 Ser-325 Phosphorylation in Human Epidermal Keratinocytes Promotes CD44 Homomeric Complexes, Binding to Ezrin, and Extended, Monocyte-adhesive Hyaluronan Coats.
25613038 2015 Prognostic and predictive role of CXCR4, IGF-1R and Ezrin expression in localized synovial sarcoma: is chemotaxis important to tumor response?
25591774 2015 Ezrin/Exocyst complex regulates mucin 5AC secretion induced by neutrophil elastase in human airway epithelial cells.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
25554515 2015 Ezrin interacts with the scaffold protein IQGAP1 and affects its cortical localization.
25544963 2014 Correlations of ezrin expression with pathological characteristics and prognosis of osteosarcoma: a meta-analysis.
25504542 2015 Inhibition of RAS activation due to a homozygous ezrin variant in patients with profound intellectual disability.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25445504 2015 Ezrin protein overexpression predicts the poor prognosis of pancreatic ductal adenocarcinomas.
25417112 2014 Target-selective protein S-nitrosylation by sequence motif recognition.
25400809 2014 MiR-199a inhibits the ability of proliferation and migration by regulating CD44-Ezrin signaling in cutaneous squamous cell carcinoma cells.
25378401 2014 NGX6a is degraded through a proteasome-dependent pathway without ubiquitination mediated by ezrin, a cytoskeleton-membrane linker.
25337200 2014 miR-183 inhibits invasion of gastric cancer by targeting Ezrin.
25304618 2015 Ezrin-expressing lung adenocarcinoma cells and podoplanin-positive fibroblasts form a malignant microenvironment.
25299115 2014 Expression of ezrin and moesin related to invasion, metastasis and prognosis of laryngeal squamous cell carcinoma.
25286001 2014 Are ERM (ezrin/radixin/moesin) proteins targets for autoantibodies in demyelinating neuropathies?
25251993 2014 miR-184 regulates ezrin, LAMP-1 expression, affects phagocytosis in human retinal pigment epithelium and is downregulated in age-related macular degeneration.
25231728 2014 A novel role for ezrin in breast cancer angio/lymphangiogenesis.
25126570 2014 PPI network analysis of mRNA expression profile of ezrin knockdown in esophageal squamous cell carcinoma.
25087457 2015 Extracellular ezrin: a novel biomarker for traumatic brain injury.
25055875 2014 MicroRNA-204, a direct negative regulator of ezrin gene expression, inhibits glioma cell migration and invasion.
25051016 2014 Ezrin is required for epithelial-mesenchymal transition induced by TGF-?1 in A549 cells.
24924175 2014 Role of ezrin in osteosarcoma metastasis.
24885195 2014 Reduced expression of ezrin in urothelial bladder cancer signifies more advanced tumours and an impaired survival: validatory study of two independent patient cohorts.
24862762 2014 NHERF1/EBP50 controls morphogenesis of 3D colonic glands by stabilizing PTEN and ezrin-radixin-moesin proteins at the apical membrane.
24788249 2014 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKC?-dependent manner.
24728215 2014 The expression and phosphorylation of ezrin and merlin in human pancreatic cancer.
24726496 2014 Ezrin is down-regulated in diabetic kidney glomeruli and regulates actin reorganization and glucose uptake via GLUT1 in cultured podocytes.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24662291 2014 Syntenin-1 and ezrin proteins link activated leukocyte cell adhesion molecule to the actin cytoskeleton.
24629131 2014 Prognostic implications of ezrin and phosphorylated ezrin expression in non-small cell lung cancer.
24614149 2014 Correlation of the Rac1/RhoA pathway with ezrin expression in osteosarcoma.
24599913 2014 Increased phosphorylation of ezrin is associated with the migration and invasion of fibroblast-like synoviocytes from patients with rheumatoid arthritis.
24500715 2014 Phosphatidylinositol 4,5-bisphosphate alters the number of attachment sites between ezrin and actin filaments: a colloidal probe study.
24462708 2014 Ezrin expression and cell survival regulation in colorectal cancer.
24413175 2014 Myosin Vb and Rab11a regulate phosphorylation of ezrin in enterocytes.
24398676 2014 AKT and GSK-3 are necessary for direct ezrin binding to NHE3 as part of a C-terminal stimulatory complex: role of a novel Ser-rich NHE3 C-terminal motif in NHE3 activity and trafficking.
24352761 2014 Clinical significance of microRNA-183/Ezrin axis in judging the prognosis of patients with osteosarcoma.
24346284 2014 Akt/Ezrin Tyr353/NF-?B pathway regulates EGF-induced EMT and metastasis in tongue squamous cell carcinoma.
24303922 2013 Upregulation of S100P, receptor for advanced glycation end products and ezrin in malignant melanoma.
24182314 2013 High expression of ezrin predicts poor prognosis in uterine cervical cancer.
24151071 2013 Interactome analysis reveals ezrin can adopt multiple conformational states.
24129929 2013 Increase in ezrin expression from benign to malignant breast tumours.
24086451 2013 ß1 integrin binding phosphorylates ezrin at T567 to activate a lipid raft signalsome driving invadopodia activity and invasion.
24014052 2014 The prognostic value of elevated ezrin in patients with osteosarcoma.
23959472 2014 Prognostic role of cytovillin expression in patients with osteosarcoma: a meta-analysis.
23900701 2013 Clinical implications of Ezrin and CD44 co?expression in breast cancer.
23894313 2013 Prognostic value of Ezrin in solid tumors: a meta-analysis of the literature.
23882136 2013 Genetic variations and polymorphisms in the ezrin gene are associated with age-related cataract.
23857773 2013 The actin-binding ERM protein Moesin binds to and stabilizes microtubules at the cell cortex.
23803027 2013 Meta-analysis of associations of the ezrin gene with human osteosarcoma response to chemotherapy and prognosis.
23766411 2013 MicroRNA-22 expression in hepatocellular carcinoma and its correlation with ezrin protein.
23752190 2014 Desmoglein 3 promotes cancer cell migration and invasion by regulating activator protein 1 and protein kinase C-dependent-Ezrin activation.
23708420 2013 Association between ezrin protein expression and the prognosis of colorectal adenocarcinoma.
23703860 2013 Human ezrin-moesin-radixin proteins modulate hepatitis C virus infection.
23629860 2013 Epidermal growth factor-induced cellular invasion requires sphingosine-1-phosphate/sphingosine-1-phosphate 2 receptor-mediated ezrin activation.
23614908 2013 Role of serine 249 of ezrin in the regulation of sodium-dependent phosphate transporter NaPi-IIa activity in renal proximal tubular cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23465281 2013 Differential ezrin and phosphorylated ezrin expression profiles between pancreatic intraepithelial neoplasia, intraductal papillary mucinous neoplasm, and invasive ductal carcinoma of the pancreas.
23435957 2013 Silence of ezrin modifies migration and actin cytoskeleton rearrangements and enhances chemosensitivity of lung cancer cells in vitro.
23422152 2013 Ezrin gene expression and protein production in the CD44(+) subpopulation of SCC-9 cells in a malignant oral cancer cell line in vitro.
23420497 2013 ERM/Rho protein expression in ductal breast cancer: a 15 year follow-up.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23394223 2013 Expression of HMGA1 and ezrin in laryngeal squamous cell carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23326330 2013 Activated ERM protein plays a critical role in drug resistance of MOLT4 cells induced by CCL25.
23325686 2013 Comparative proteomic analysis of HIV-1 particles reveals a role for Ezrin and EHD4 in the Nef-dependent increase of virus infectivity.
23324233 2012 [Effects of ezrin silencing on pancreatic cancer cell line Panc-1].
23264465 2013 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23214316 2012 [The study of the correlation of papillary thyroid carcinoma's invasion toward Ezrin and E-cadherin].
23209815 2012 Fascin-1, ezrin and paxillin contribute to the malignant progression and are predictors of clinical prognosis in laryngeal squamous cell carcinoma.
23209304 2012 Local phosphocycling mediated by LOK/SLK restricts ezrin function to the apical aspect of epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185364 2012 Ezrin interacts with the SARS coronavirus Spike protein and restrains infection at the entry stage.
23116763 2013 Control of adipogenesis by ezrin, radixin and moesin-dependent biomechanics remodeling.
23106337 2013 Sphingosine 1-phosphate induces filopodia formation through S1PR2 activation of ERM proteins.
23098471 2012 Knockdown of Ezrin by RNA interference reverses malignant behavior of human pancreatic cancer cells in vitro.
23067217 2013 Altered expression of ezrin, E-Cadherin and ?-Catenin in cervical neoplasia.
23039327 2012 Ezrin overexpression predicts the poor prognosis of gastric adenocarcinoma.
23031255 2012 Lipid raft association restricts CD44-ezrin interaction and promotion of breast cancer cell migration.
23017497 2013 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
22967445 2012 [Expression of ezrin in human non-small cell lung cancer and its relationship with metastasis and prognosis].
22964850 2012 NHERF1 and CFTR restore tight junction organisation and function in cystic fibrosis airway epithelial cells: role of ezrin and the RhoA/ROCK pathway.
22927432 2012 Open conformation of ezrin bound to phosphatidylinositol 4,5-bisphosphate and to F-actin revealed by neutron scattering.
22922800 2012 miR-183 inhibits the metastasis of osteosarcoma via downregulation of the expression of Ezrin in F5M2 cells.
22898813 2012 Cryptococcus neoformans activates RhoGTPase proteins followed by protein kinase C, focal adhesion kinase, and ezrin to promote traversal across the blood-brain barrier.
22891241 2012 Ezrin/radixin/moesin are required for the purinergic P2X7 receptor (P2X7R)-dependent processing of the amyloid precursor protein.
22869145 2013 Global analysis of L1-transcriptomes identified IGFBP-2 as a target of ezrin and NF-?B signaling that promotes colon cancer progression.
22843905 2012 Main effects and interactions of carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 in multivariate analysis for disease outcome in rectal cancer.
22805611 2012 Advanced glycation end-products induce calpain-mediated degradation of ezrin.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22685202 2012 Anoctamin 1 (Tmem16A) Ca2+-activated chloride channel stoichiometrically interacts with an ezrin-radixin-moesin network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22629406 2012 Ezrin ubiquitylation by the E3 ubiquitin ligase, WWP1, and consequent regulation of hepatocyte growth factor receptor activity.
22628548 2012 Ezrin-anchored protein kinase A coordinates phosphorylation-dependent disassembly of a NHERF1 ternary complex to regulate hormone-sensitive phosphate transport.
22577345 2012 The ezrin metastatic phenotype is associated with the initiation of protein translation.
22544491 2012 RNAi-mediated blocking of ezrin reduces migration of ectopic endometrial cells in endometriosis.
22528947 2012 Expression of ezrin correlates with malignant phenotype of lung cancer, and in vitro knockdown of ezrin reverses the aggressive biological behavior of lung cancer cells.
22476538 2012 Ezrin and BCAR1/p130Cas mediate breast cancer growth as 3-D spheroids.
22467863 2012 Radixin regulates cell migration and cell-cell adhesion through Rac1.
22415480 2012 Atypical ezrin localization as a marker of locally advanced breast cancer.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22291017 2012 Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
22234584 2012 Ezrin expression in rectal cancer predicts time to development of local recurrence.
22230495 2012 [Transcriptional regulatory properties of DNA sequence upstream of the human ezrin gene promoter in nasopharyngeal carcinoma cells].
22228328 2012 Expression of ezrin, MMP-9, and COX-2 in 50 chordoma specimens: a clinical and immunohistochemical analysis.
22199327 2011 Carbonic anhydrase IX, hypoxia-inducible factor-1?, ezrin and glucose transporter-1 as predictors of disease outcome in rectal cancer: multivariate Cox survival models following data reduction by principal component analysis of the clinicopathological predictors.
22192140 2012 Expression and activation of the membrane-cytoskeleton protein ezrin during the normal endometrial cycle.
22177047 2011 [Study of the correlation of papillary thyroid carcinoma's invasion with Ezrin, Moesin and E-Cadherin].
22172411 2012 Expression of ezrin, HGF and c-met and its clinicopathological significance in the benign and malignant lesions of the gallbladder.
22137559 2012 Expression and clinical significance of ezrin in non--small-cell lung cancer.
22132106 2011 Activation of Ras requires the ERM-dependent link of actin to the plasma membrane.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21971708 2012 Phosphorylated T567 ezrin is associated with merlin expression in KIT-mutant gastrointestinal stromal tumors.
21915031 2011 Tissue microarray analysis of ezrin, KBA.62, CD166, nestin, and p-Akt in melanoma versus banal and atypical nevi, and nonmelanocytic lesions.
21909685 2012 Wilms tumor-1, claudin-1 and ezrin are useful immunohistochemical markers that help to distinguish schwannoma from fibroblastic meningioma.
21899702 2011 The ERM protein, ezrin, regulates neutrophil transmigration by modulating the apical localization of MRP2 in response to the SipA effector protein during Salmonella Typhimurium infection.
21878630 2011 N,N'-dinitrosopiperazine-mediated ezrin protein phosphorylation via activation of Rho kinase and protein kinase C is involved in metastasis of nasopharyngeal carcinoma 6-10B cells.
21874375 2011 Expression and significance of Six1 and Ezrin in cervical cancer tissue.
21873785 2011 Berberine inhibits the invasion and metastasis of nasopharyngeal carcinoma cells through Ezrin phosphorylation.
21868260 2013 Decreased ezrin and paxillin expression in human urothelial bladder tumors correlate with tumor progression.
21864676 2011 Differential involvement of ezrin/radixin/moesin proteins in sphingosine 1-phosphate-induced human pulmonary endothelial cell barrier enhancement.
21849257 2011 Immunohistochemical expression of ezrin in cutaneous basal and squamous cell carcinomas.
21837648 2011 Effect of knockdown of ezrin, radixin, and moesin on P-glycoprotein function in HepG2 cells.
21818323 2011 17?-Estradiol enhances breast cancer cell motility and invasion via extra-nuclear activation of actin-binding protein ezrin.
21789023 Low-dose epirubicin inhibits ezrin-mediated metastatic behavior of breast cancer cells.
21780101 2012 P-glycoprotein binds to ezrin at amino acid residues 149-242 in the FERM domain and plays a key role in the multidrug resistance of human osteosarcoma.
21751142 2011 Up-regulated expression of Ezrin and c-Met proteins are related to the metastasis and prognosis of gastric carcinomas.
21717114 2011 Ezrin is associated with gastric cancer progression and prognosis.
21712385 2011 The tumor suppressor hamartin enhances Dbl protein transforming activity through interaction with ezrin.
21672629 2011 Apical membrane segregation of phosphatidylinositol-4,5-bisphosphate influences parathyroid hormone 1 receptor compartmental signaling and localization via direct regulation of ezrin in LLC-PK1 cells.
21659656 2011 Ezrin, radixin, and moesin are phosphorylated in response to 2-methoxyestradiol and modulate endothelial hyperpermeability.
21628504 2011 Potential transcriptional regulatory regions exist upstream of the human ezrin gene promoter in esophageal carcinoma cells.
21625943 2011 Expression of ezrin correlates with poor prognosis of nasopharyngeal carcinoma.
21585339 2011 Identification of the VIL2 enhancer in human embryonic kidney cells.
21550270 2011 Expression of the membrane-cytoskeletal linker Ezrin in salivary gland adenoid cystic carcinoma.
21540295 2011 Ezrin is required for efficient Rap1-induced cell spreading.
21465252 2011 Ezrin expression as a prognostic marker in colorectal adenocarcinoma.
21444753 2011 An ezrin-rich, rigid uropod-like structure directs movement of amoeboid blebbing cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21416469 2011 Prognostic implication of ezrin expression in esophageal squamous cell carcinoma.
21412073 2011 Different roles of S100P overexpression in intrahepatic cholangiocarcinoma: carcinogenesis of perihilar type and aggressive behavior of peripheral type.
21363921 2011 Rho kinase phosphorylation promotes ezrin-mediated metastasis in hepatocellular carcinoma.
21352885 2011 ERM stable knockdown by siRNA reduced in vitro migration and invasion of human SGC-7901 cells.
21340023 2011 Rapid cytoskeletal response of epithelial cells to force generation by type IV pili.
21282970 2011 Knockdown of ezrin via RNA interference suppresses Helicobacter pylori-enhanced invasion of gastric cancer cells.
21282464 2011 A novel role for BRCA1 in regulating breast cancer cell spreading and motility.
21278261 2011 Interplay between RAGE, CD44, and focal adhesion molecules in epithelial-mesenchymal transition of alveolar epithelial cells.
21278069 2011 Increased phosphorylation of ezrin/radixin/moesin proteins contributes to proliferation of rheumatoid fibroblast-like synoviocytes.
21269460 2011 Initial characterization of the human central proteome.
21190723 2011 Preoperative radiotherapy modulates ezrin expression and its value as a predictive marker in patients with rectal cancer.
21176563 2010 [Potential role of ezrin and its related microRNA in ovarian cancer invasion and metastasis].
21171946 2011 HRV signaling in airway epithelial cells is regulated by ITAM-mediated recruitment and activation of Syk.
21148287 2011 The ERM proteins interact with the HOPS complex to regulate the maturation of endosomes.
20873751 2010 Phosphatidylinositol 4,5-bisphosphate-induced conformational change of ezrin and formation of ezrin oligomers.
20872967 2010 Up-regulation of hnRNP A1, Ezrin, tubulin ?-2C and Annexin A1 in sentinel lymph nodes of colorectal cancer.
20871163 2010 [Expression of Ezrin and E-cadherin in nasopharyngeal carcinoma and its significance].
20859706 2011 Expression change of ezrin as a prognostic factor in primary osteosarcoma.
20855527 2010 Spatial regulation of cyclic AMP-Epac1 signaling in cell adhesion by ERM proteins.
20811677 2010 Role for ezrin in breast cancer cell chemotaxis to CCL5.
20711218 2010 The role of ezrin-associated protein network in human sperm capacitation.
20701102 2009 Ezrin immunoreactivity in renal cell carcinomas.
20679347 2010 Differential effects of ceramide and sphingosine 1-phosphate on ERM phosphorylation: probing sphingolipid signaling at the outer plasma membrane.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20585869 2010 Prognostic implication of ezrin overexpression in myxofibrosarcomas.
20569470 2010 Ezrin promotes invasion and metastasis of pancreatic cancer cells.
20562647 2010 Immunoexpression of Ezrin and CD44 in patients with osteosarcoma.
20558337 2010 Subcellular distribution and expression of cofilin and ezrin in human colon adenocarcinoma cell lines with different metastatic potential.
20552365 2010 Ezrin immunohistochemical expression in chondrosarcomas, osteosarcomas and Ewing sarcoma family of tumors.
20551903 2010 Ezrin tunes T-cell activation by controlling Dlg1 and microtubule positioning at the immunological synapse.
20501702 2010 Nuclear factor-kappaB signaling and ezrin are essential for L1-mediated metastasis of colon cancer cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20442317 2010 An isoform-specific PDZ-binding motif targets type I PIP5 kinase beta to the uropod and controls polarization of neutrophil-like HL60 cells.
20395446 2010 Podocalyxin EBP50 ezrin molecular complex enhances the metastatic potential of renal cell carcinoma through recruiting Rac1 guanine nucleotide exchange factor ARHGEF7.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363977 2010 Ezrin, maspin, peroxiredoxin 2, and heat shock protein 27: potential targets of a streptococcal-induced autoimmune response in psoriasis.
20348881 2010 Phosphorylated ezrin is located in the nucleus of the osteosarcoma cell.
20335315 2010 CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity.
20237154 2010 A regulated complex of the scaffolding proteins PDZK1 and EBP50 with ezrin contribute to microvillar organization.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20193117 2010 Expression and clinical significance of Ezrin and E-cadherin in esophageal squamous cell carcinoma.
20156804 2010 Overexpression of ezrin inactivates NF2 tumor suppressor in glioblastoma.
20128822 2010 Initiation of malignancy by duodenal contents reflux and the role of ezrin in developing esophageal squamous cell carcinoma.
20036004 2010 Ezrin is a key molecule in the metastasis of MOLT4 cells induced by CCL25/CCR9.
20010876 2010 Ezrin mediates c-Myc actions in prostate cancer cell invasion.
19946888 2010 Defining the membrane proteome of NK cells.
19935704 2010 Ezrin is a negative regulator of death receptor-induced apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890007 2009 Phosphorylation of ezrin/radixin/moesin proteins by LRRK2 promotes the rearrangement of actin cytoskeleton in neuronal morphogenesis.
19830727 2009 Regulation of NK cell trafficking by CD81.
19799816 2009 [Ezrin and inducible nitric oxide synthase in malignant proliferation of salivary gland pleomorphic adenoma].
19786985 2009 Internalization of NK cells into tumor cells requires ezrin and leads to programmed cell-in-cell death.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19654214 2009 Engagement of CD81 induces ezrin tyrosine phosphorylation and its cellular redistribution with filamentous actin.
19648886 2009 Ezrin overexpression in gastrointestinal stromal tumors: an independent adverse prognosticator associated with the non-gastric location.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19604375 2009 Expression of ezrin is associated with invasion and dedifferentiation of hepatitis B related hepatocellular carcinoma.
19597468 2009 Beta4 integrin promotes osteosarcoma metastasis and interacts with ezrin.
19591839 2009 Ezrin induces long-range interdomain allostery in the scaffolding protein NHERF1.
19575999 2009 [Effects of Ezrin gene on the proliferation and invasion activity of human salivary gland adenoid cystic carcinoma].
19556366 2009 The calcineurin homologous protein-1 increases Na(+)/H(+) -exchanger 3 trafficking via ezrin phosphorylation.
19555689 2009 MCC, a new interacting protein for Scrib, is required for cell migration in epithelial cells.
19550117 2009 Effect of RhoA signaling transduction on expression of Ezrin in breast cancer cell lines.
19399936 2009 High level of ezrin expression in colorectal cancer tissues is closely related to tumor malignancy.
19386264 2009 Mst4 and Ezrin induce brush borders downstream of the Lkb1/Strad/Mo25 polarization complex.
19366061 Expression of ezrin and metastatic tumor antigen in osteosarcomas of the jaw.
19331807 2009 Expression of Ezrin correlates with lung metastasis in Chinese patients with osteosarcoma.
19255442 2009 LOK is a major ERM kinase in resting lymphocytes and regulates cytoskeletal rearrangement through ERM phosphorylation.
19234486 2009 Phosphorylated ezrin is associated with EBV latent membrane protein 1 in nasopharyngeal carcinoma and induces cell migration.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19165868 2009 Roles of ezrin in the growth and invasiveness of esophageal squamous carcinoma cells.
19164283 2009 Sp1 and AP-1 regulate expression of the human gene VIL2 in esophageal carcinoma cells.
19152423 2009 Proteomic profiling in pancreatic cancer with and without lymph node metastasis.
19129194 2009 In Vitro and in Vivo Characterization of Molecular Interactions between Calmodulin, Ezrin/Radixin/Moesin, and L-selectin.
19124745 2009 Ezrin and moesin function together to promote T cell activation.
19111582 2009 Generation and characterization of a novel, permanently active S100P mutant.
19088174 2009 The role of the membrane cytoskeleton cross-linker ezrin in medulloblastoma cells.
19084535 2009 Properties of an ezrin mutant defective in F-actin binding.
19080005 2008 [Expression and significance of Ezrin gene in pancreatic carcinoma tissues].
19060919 2009 The actin-cytoskeleton linker protein ezrin is regulated during osteosarcoma metastasis by PKC.
19050913 2009 Ezrin immunohistochemical expression in cartilaginous tumours: a useful tool for differential diagnosis between chondroblastic osteosarcoma and chondrosarcoma.
18997619 2009 The classic prognostic factors tumor stage, tumor size, and tumor grade are the strongest predictors of outcome in synovial sarcoma: no role for SSX fusion type or ezrin expression.
18941185 2008 Rho-ROCK-dependent ezrin-radixin-moesin phosphorylation regulates Fas-mediated apoptosis in Jurkat cells.
18926620 2009 Protein expression patterns of ezrin are predictors of progression in T1G3 bladder tumours treated with nonmaintenance bacillus Calmette-Guérin.
18852256 2009 Ezrin interacts with cortactin to form podosomal rosettes in pancreatic cancer cells.
18840437 2008 MicroRNA-183 regulates Ezrin expression in lung cancer cells.
18788632 2008 [Relationship of ezrin protein expression to the carcinogenesis and prognosis of infitrating breast ductal carcinoma].
18725408 2008 Characterization of the Ca2+ -regulated ezrin-S100P interaction and its role in tumor cell migration.
18701134 2008 Intense cytoplasmic ezrin immunoreactivity predicts poor survival in colorectal cancer.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18552365 2008 Regulation and activation of ezrin protein in endometriosis.
18545143 2008 Primary hepatic malignant fibrous histiocytoma: clinicopathologic characteristics and prognostic value of ezrin expression.
18508927 2008 A novel juxtamembrane domain in tumor necrosis factor receptor superfamily molecules activates Rac1 and controls neurite growth.
18486367 2008 Ezrin is a key element in the human vagina.
18459457 2007 Prognostic significance of E-cadherin and ezrin immunohistochemical expression in prostate cancer.
18425081 2008 Ezrin expression is associated with hepatocellular carcinoma possibly derived from progenitor cells and early recurrence after surgical resection.
18305045 2008 The Ezrin-radixin-moesin family member ezrin regulates stable microtubule formation and retroviral infection.
18295815 2008 Ezrin, Radixin, and Moesin (ERM) proteins function as pleiotropic regulators of human immunodeficiency virus type 1 infection.
18270268 2008 Atypical protein kinase C (iota) activates ezrin in the apical domain of intestinal epithelial cells.
18246799 2007 [Expression of ezrin and CD44-v6 in human esophageal squamous cell carcinoma and its clinical significance].
18203644 2008 Localization of the ezrin binding epitope for advanced glycation endproducts.
18155831 2008 Ezrin silencing by small hairpin RNA reverses metastatic behaviors of human breast cancer cells.
18078820 2008 Ezrin is a specific and direct target of protein tyrosine phosphatase PRL-3.
18046454 2008 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17886294 2008 Prognostic significance of immunohistochemical expression of ezrin in non-metastatic high-grade osteosarcoma.
17881735 2007 Interaction of ezrin with the novel guanine nucleotide exchange factor PLEKHG6 promotes RhoG-dependent apical cytoskeleton rearrangements in epithelial cells.
17825285 2007 Ezrin and radixin both regulate the apical membrane localization of ABCC2 (MRP2) in human intestinal epithelial Caco-2 cells.
17786474 2007 Ezrin and alpha-smooth muscle actin are immunohistochemical prognostic markers in conventional osteosarcomas.
17726647 2007 The CD44 standard/ezrin complex regulates Fas-mediated apoptosis in Jurkat cells.
17659733 2007 Association of ezrin expression in intestinal and diffuse gastric carcinoma with clinicopathological parameters and tumor type.
17616675 2007 Podocalyxin increases the aggressive phenotype of breast and prostate cancer cells in vitro through its interaction with ezrin.
17538024 2007 Activated ezrin promotes cell migration through recruitment of the GEF Dbl to lipid rafts and preferential downstream activation of Cdc42.
17525629 2007 The cytoskeletal proteins alpha-actinin, Ezrin, and talin are De-expressed in endometriosis and endometrioid carcinoma compared with normal uterine epithelium.
17515952 Gene expression in temporal lobe epilepsy is consistent with increased release of glutamate by astrocytes.
17370041 2007 Expression of the cytoskeleton linker protein ezrin in human cancers.
17370040 2007 Parathyroid hormone-related protein and ezrin are up-regulated in human lung cancer bone metastases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17242191 2007 NHERF1/EBP50 head-to-tail intramolecular interaction masks association with PDZ domain ligands.
17237445 2007 Phosphorylated ERM is responsible for increased T cell polarization, adhesion, and migration in patients with systemic lupus erythematosus.
17028919 2006 Ezrin mediates growth and survival in Ewing's sarcoma through the AKT/mTOR, but not the MAPK, signaling pathway.
16889625 2007 Pseudomonas aeruginosa ExoS ADP-ribosyltransferase inhibits ERM phosphorylation.
16873375 2006 Androgen induction of prostate cancer cell invasion is mediated by ezrin.
16867268 2006 [The effects of ezrin on the proliferation and the invasiveness of cells of different hepatocellular carcinoma cell lines].
16677779 2006 Ezrin in osteosarcoma: comparison between conventional high-grade and central low-grade osteosarcoma.
16648854 2006 Quantitative proteomic analysis of B cell lipid rafts reveals that ezrin regulates antigen receptor-mediated lipid raft dynamics.
16633060 2006 Ezrin promotes ovarian carcinoma cell invasion and its retained expression predicts poor prognosis in ovarian carcinoma.
16554733 2006 Ezrin expression is related to poor prognosis in FIGO stage I endometrioid carcinomas.
16538541 2006 Abnormal ezrin localization is associated with clinicopathological features in invasive breast carcinomas.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16438931 2006 PKA-mediated protein phosphorylation regulates ezrin-WWOX interaction.
16352594 2006 Ezrin directly interacts with the alpha1b-adrenergic receptor and plays a role in receptor recycling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230228 2005 Ezrin expression in prostate cancer and benign prostatic tissue.
16144921 2005 Prognostic impact of immunohistochemical expression of ezrin in highly malignant soft tissue sarcomas.
16129695 2005 Ezrin controls the macromolecular complexes formed between an adapter protein Na+/H+ exchanger regulatory factor and the cystic fibrosis transmembrane conductance regulator.
15843435 2005 G protein-coupled receptor kinase 2-mediated phosphorylation of ezrin is required for G protein-coupled receptor-dependent reorganization of the actin cytoskeleton.
15835821 2004 [Research of fibronectin, p53 and Ezrin protein with occurrence, progress and prognosis in the primary laryngeal carcinoma by the tissuechip technology].
15797715 2005 Characterization of the NF2 protein merlin and the ERM protein ezrin in human, rat, and mouse central nervous system.
15751968 2005 Ezrin mutants affecting dimerization and activation.
15729356 2005 Listeria monocytogenes exploits ERM protein functions to efficiently spread from cell to cell.
15677456 2005 PALS1 specifies the localization of ezrin to the apical membrane of gastric parietal cells.
15647376 2005 Src-dependent ezrin phosphorylation in adhesion-mediated signaling.
15623525 2005 Src phosphorylates ezrin at tyrosine 477 and induces a phosphospecific association between ezrin and a kelch-repeat protein family member.
15531580 2005 Akt2 phosphorylates ezrin to trigger NHE3 translocation and activation.
15498789 2005 Role of a novel EGF-like domain-containing gene NGX6 in cell adhesion modulation in nasopharyngeal carcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252013 2004 Ezrin/radixin/moesin proteins are high affinity targets for ADP-ribosylation by Pseudomonas aeruginosa ExoS.
15178693 2004 Mutagenesis of the ezrin-radixin-moesin binding domain of L-selectin tail affects shedding, microvillar positioning, and leukocyte tethering.
15149851 2004 Nuclear ERM (ezrin, radixin, moesin) proteins: regulation by cell density and nuclear import.
15096511 2004 The NHE1 Na+/H+ exchanger recruits ezrin/radixin/moesin proteins to regulate Akt-dependent cell survival.
15020681 2004 The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain.
14981079 2004 Cyclic AMP-dependent protein kinase phosphorylates merlin at serine 518 independently of p21-activated kinase and promotes merlin-ezrin heterodimerization.
14704791 2004 The membrane-cytoskeleton linker ezrin is necessary for osteosarcoma metastasis.
14704789 2004 Expression profiling identifies the cytoskeletal organizer ezrin and the developmental homeoprotein Six-1 as key metastatic regulators.
14676203 2004 Identification and relevance of the CD95-binding domain in the N-terminal region of ezrin.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12860416 2003 Identification of a novel Ezrin-binding site in syndecan-2 cytoplasmic domain.
12808036 2003 Ca2+-dependent binding and activation of dormant ezrin by dimeric S100P.
12800220 2003 Upregulated expression of Ezrin and invasive phenotype in malignantly transformed esophageal epithelial cells.
12769842 2003 Increased ezrin expression and activation by CDK5 coincident with acquisition of the senescent phenotype.
12734202 2003 The amino-terminal domains of the ezrin, radixin, and moesin (ERM) proteins bind advanced glycation end products, an interaction that may play a role in the development of diabetic complications.
12711360 2003 The role of the CD44/ezrin complex in cancer metastasis.
12651155 2003 PACE-1, a novel protein that interacts with the C-terminal domain of ezrin.
12626536 2003 The size of the synaptic cleft and distinct distributions of filamentous actin, ezrin, CD43, and CD45 at activating and inhibitory human NK cell immune synapses.
12560083 2003 Ezrin is a substrate for Lck in T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429733 2003 Structure of the active N-terminal domain of Ezrin. Conformational and mobility changes identify keystone interactions.
12385025 2002 Differential expression and distribution of ezrin, radixin and moesin in human natural killer cells.
12370738 2002 Distribution and expression of CD44 isoforms and Ezrin during prostate cancer-endothelium interaction.
12360288 2002 Dmoesin controls actin-based cell shape and polarity during Drosophila melanogaster oogenesis.
12271120 2002 Molecular analysis of microscopic ezrin dynamics by two-photon FRAP.
12154370 2002 ERM proteins and merlin: integrators at the cell cortex.
12111362 2002 Ezrin and moesin expression within the developing human cerebrum and tuberous sclerosis-associated cortical tubers.
12082081 2002 Dynamic interaction of VCAM-1 and ICAM-1 with moesin and ezrin in a novel endothelial docking structure for adherent leukocytes.
12082080 2002 L1 endocytosis is controlled by a phosphorylation-dephosphorylation cycle stimulated by outside-in signaling by L1.
12080047 2002 The adenosine 2b receptor is recruited to the plasma membrane and associates with E3KARP and Ezrin upon agonist stimulation.
12070130 2002 Functional binding interaction identified between the axonal CAM L1 and members of the ERM family.
12032545 2002 A novel PKC-regulated mechanism controls CD44 ezrin association and directional cell motility.
11784723 2002 A novel serine-rich motif in the intercellular adhesion molecule 3 is critical for its ezrin/radixin/moesin-directed subcellular targeting.
11726633 2001 Polarity and developmental regulation of two PDZ proteins in the retinal pigment epithelium.
11706008 2002 The cytoplasmic tail of L-selectin interacts with members of the Ezrin-Radixin-Moesin (ERM) family of proteins: cell activation-dependent binding of Moesin but not Ezrin.
11598191 2001 Characterization of human palladin, a microfilament-associated protein.
11468295 2001 Ezrin interacts with focal adhesion kinase and induces its activation independently of cell-matrix adhesion.
11438984 2001 Ezrin, radixin, and moesin are components of Schwann cell microvilli.
11387207 2001 Ezrin is a downstream effector of trafficking PKC-integrin complexes involved in the control of cell motility.
11285285 2001 Identification of EPI64, a TBC/rabGAP domain-containing microvillar protein that binds to the first PDZ domain of EBP50 and E3KARP.
11013215 2000 CD95 (APO-1/Fas) linkage to the actin cytoskeleton through ezrin in human T lymphocytes: a novel regulatory mechanism of the CD95 apoptotic pathway.
10970850 2000 Ezrin function is required for ROCK-mediated fibroblast transformation by the Net and Dbl oncogenes.
10955717 2000 Ezrin, a membrane-organizing protein, as a polarization marker of the retinal pigment epithelium in vertebrates.
10893422 2000 E3KARP mediates the association of ezrin and protein kinase A with the cystic fibrosis transmembrane conductance regulator in airway cells.
10806479 2000 The TSC1 tumour suppressor hamartin regulates cell adhesion through ERM proteins and the GTPase Rho.
10793131 2000 Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli.
10733515 2000 Polarization and interaction of adhesion molecules P-selectin glycoprotein ligand 1 and intercellular adhesion molecule 3 with moesin and ezrin in myeloid cells.
10713718 2000 The HIV-1 vpr protein induces anoikis-resistance by modulating cell adhesion process and microfilament system assembly.
10704377 2000 Ezrin links syndecan-2 to the cytoskeleton.
10462524 1999 Ezrin regulates cell-cell and cell-matrix adhesion, a possible role with E-cadherin/beta-catenin.
10377409 1999 Ezrin, a plasma membrane-microfilament linker, signals cell survival through the phosphatidylinositol 3-kinase/Akt pathway.
10036239 1999 Homotypic and heterotypic interaction of the neurofibromatosis 2 tumor suppressor protein merlin and the ERM protein ezrin.
9928947 1999 Moesin, the major ERM protein of lymphocytes and platelets, differs from ezrin in its insensitivity to calpain.
9921900 1998 Genomic structure of the human ezrin gene.
9852149 1998 The localization of myosin VI at the golgi complex and leading edge of fibroblasts and its phosphorylation and recruitment into membrane ruffles of A431 cells after growth factor stimulation.
9748260 1998 NHE3 kinase A regulatory protein E3KARP binds the epithelial brush border Na+/H+ exchanger NHE3 and the cytoskeletal protein ezrin.
9705328 1998 Association of ezrin with intercellular adhesion molecule-1 and -2 (ICAM-1 and ICAM-2). Regulation by phosphatidylinositol 4, 5-bisphosphate.
9616160 1998 CD43 interacts with moesin and ezrin and regulates its redistribution to the uropods of T lymphocytes at the cell-cell contacts.
9501018 1998 Mapping of ezrin dimerization using yeast two-hybrid screening.
9314537 1997 Identification of EBP50: A PDZ-containing phosphoprotein that associates with members of the ezrin-radixin-moesin family.
9287351 1997 Direct interaction of the Rho GDP dissociation inhibitor with ezrin/radixin/moesin initiates the activation of the Rho small G protein.
8892894 1996 Cytoskeletal proteins inside human immunodeficiency virus type 1 virions.
8713105 1996 Identification of the 70kD heat shock cognate protein (Hsc70) and alpha-actinin-1 as novel phosphotyrosine-containing proteins in T lymphocytes.
8248180 1993 Heterotypic and homotypic associations between ezrin and moesin, two putative membrane-cytoskeletal linking proteins.
8162705 1994 Subregional mapping of 8 single copy loci to chromosome 6 by fluorescence in situ hybridization.
8089177 1994 Ezrin has a COOH-terminal actin-binding site that is conserved in the ezrin protein family.
7876308 1995 Indirect association of ezrin with F-actin: isoform specificity and calcium sensitivity.
7844168 1994 Ezrin has properties to self-associate at the plasma membrane.
7579708 1995 Ezrin self-association involves binding of an N-terminal domain to a normally masked C-terminal domain that includes the F-actin binding site.
2674140 1989 Cytovillin, a microvillar Mr 75,000 protein. cDNA sequence, prokaryotic expression, and chromosomal localization.
2592436 1989 Cytovillin and other microvillar proteins of human choriocarcinoma cells.
2591371 1989 cDNA cloning and sequencing of the protein-tyrosine kinase substrate, ezrin, reveals homology to band 4.1.
1924289 1991 Moesin: a member of the protein 4.1-talin-ezrin family of proteins.
1762625 1991 Cloning and characterisation of an immunodominant major surface antigen of Echinococcus multilocularis.
1382070 1992 Identification of the two major epidermal growth factor-induced tyrosine phosphorylation sites in the microvillar core protein ezrin.
1381389 1992 Identification of ezrin as an 81-kDa tyrosine-phosphorylated protein in T cells.
1159819 1975 Activation of carcinogenic arylhydroxamic acids by human tissues.