Property Summary

NCBI Gene PubMed Count 564
PubMed Score 1194.55
PubTator Score 933.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Immune system cancer 38 0.0 1.0
Lymphoid leukemia 69 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 5.926 3.0
Disease Target Count
Weaver syndrome 6

Expression

  Differential Expression (29)

Disease log2 FC p
osteosarcoma -2.681 4.3e-03
malignant mesothelioma 2.100 2.5e-08
astrocytoma 1.800 1.8e-14
posterior fossa group A ependymoma 2.300 1.5e-07
oligodendroglioma 1.900 1.0e-10
glioblastoma 3.300 1.5e-11
group 3 medulloblastoma 4.800 1.2e-09
atypical teratoid / rhabdoid tumor 3.300 1.1e-07
medulloblastoma, large-cell 3.600 3.7e-06
primitive neuroectodermal tumor 4.100 1.3e-07
adrenocortical carcinoma 2.356 7.5e-06
non-small cell lung cancer 2.558 9.0e-24
intraductal papillary-mucinous carcinoma... 3.000 1.0e-04
intraductal papillary-mucinous neoplasm ... 2.600 1.3e-03
lung cancer 3.400 5.9e-06
pancreatic cancer 1.200 6.5e-06
breast carcinoma 1.500 1.2e-04
Breast cancer 3.400 2.6e-02
interstitial cystitis 1.900 5.0e-03
lung adenocarcinoma 1.500 2.3e-09
pediatric high grade glioma 3.200 1.7e-08
pilocytic astrocytoma 1.300 1.0e-04
primary Sjogren syndrome 1.300 1.5e-02
psoriasis 1.300 2.8e-130
nasopharyngeal carcinoma 1.400 7.4e-06
ductal carcinoma in situ 2.600 3.8e-04
invasive ductal carcinoma 2.900 5.4e-04
ovarian cancer 1.700 1.3e-04
cystic fibrosis and chronic rhinosinusit... 1.139 5.4e-03

 OMIM Phenotype (1)

Gene RIF (518)

PMID Text
27113214 EZH2 overexpression is associated aggressive pathologic features including high nuclear grade, high proliferative index, and positivity of HER2 of breast carcinoma.
26970171 Down-regulation of EZH2 expression is associated with myelodysplastic syndromes.
26964089 Uropathogen-induced paracrine factors act epigenetically by altering expression of EZH2, which plays a key role in early host cell proliferative responses to infection.
26897964 EZH2 mediates the regulation of E-cadherin expression by S100A4 and controls the proliferation and migration of gastric cancer cells.
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26871869 JMJD3 and EZH2 in prostate biopsies also demonstrated an increase of JMJD3 and EZH2 in adenocarcinoma with Gleason score 7 and 8 by comparison with a normal biopsy.
26781064 an imbalanced double-negative feedback loop between EZH2 and miR-26a exists in HCC cells, which contributes to miR-26a deregulation and regulates tumor cells proliferation
26766588 Modulation of Polycomb repressive complexes by either Ezh2 overexpression or Eed deletion enhances KRAS-driven adenomagenesis and inflammation
26735435 the expression of metastasis associated 1 family, member 2 and enhancer of zeste 2 polycomb repressive complex 2 subunit correlated negatively with expression of tuberous sclerosis 2
26733151 Data indicate that microRNA miR-26a regulated epithelial-mesenchymal transition (EMT) by targeting enhancer of zeste homolog 2 (EZH2).
26718325 Ectopic expression of EZH2 inhibited the transcriptional activities of miR-101-1 promoter. Subsequent analyses revealed that miR-101-1 directly represses the expression of EZH2, and miR-101-1 and EZH2 form a reciprocal negative feedback loop.
26683709 High EZH2 expression was significantly associated with different types of breast cancer.
26659825 Results uncovered the collaboration between EZH2 and E2F1 in controlling downstream genes that are highly expressed in aggressive tumors.
26655220 WT1 isoforms induce an array of miRNAs, which target the 3' UTR of EZH2 and other Polycomb-associated transcripts.
26648239 The miR-335 expression was inversely correlated with Sox4 expression in the identical clinical specimens, but it was not related to the prognosis. Sox4/Ezh2 axis was closely associated with the prognosis in pancreatic cancer patients
26632198 Data suggest that depletion of [human] EZH2 (enhancer of zeste homolog 2 protein) leads to up-regulation of [HIV-1] Tat-mediated HIV-1 transactivation; Tat up-regulates phosphorylation and cytoplasmic translocation of EZH2.
26593398 EZH2 is highly expressed in pituitary adenomas, positively associated with Ki-67 expression, and associated with proliferation.
26590165 Study shows that EZH2 is overexpressed in multiple myeloma and proposes that it plays an important role in multiple myeloma development and progression.
26587974 p53 gain-of-function mutations accelerate endometrial carcinoma progression and metastasis by interfering with Drosha and p68 binding and pri-miR-26a-1 processing, resulting in reduced miR-26a expression and EZH2 overexpression.
26573802 Mechanistic investigations revealed that miR-124 directly downregulated AR splice variants AR-V4 and V7 along with EZH2 and Src
26553291 EZH2 rs3757441 C/C genotype is associated with stronger EZH2 and H3K27me3 immunoreactivity in primary colorectal cancer : this SNP may serve as a promising biomarker for EZH2-targeting agents
26552012 EZH2 might contribute to the genetic etiology of autism in Chinese Han population
26552009 SWI/SNF-mutant cancer cells are primarily dependent on a non-catalytic role of EZH2 in the stabilization of the PRC2 complex.
26517694 Phosphorylation-mediated EZH2 inactivation promotes drug resistance in multiple myeloma.
26517683 Data show that increased polycomb repressive complex 2 EZH2 and/or polycomb repressive complex 1 BMI1 expression repress the expression of microRNA miR-200 family members.
26517640 Cancer stem cell markers are variably expressed in prostate adenocarcinoma and immunohistochemical staining for ALDH1 and EZH2 may have a role in predicting tumour aggressiveness before treatment of prostate cancer
26517514 Data show a mutual suppression regulation between chromodomain helicase DNA binding protein 5 (CHD5) and enhancer of zeste homolog 2 (EZH2, which may provide new insights into their potential therapeutic significance for hepatocellular carcinoma (HCC).
26516927 Data show that long non-coding RNA MALAT1 may be a crucial RNA cofactor of Polycomb protein enhancer of zeste homolog 2 (EZH2) and that may provide a new avenue for development new strategies for treatment of castration-resistant prostate cancer (CRPC).
26499080 study provides evidence that epigenetic regulation of Reelin by Ezh2 maintains appropriate Reelin expression pattern to fulfill proper orientation of migrating neurons
26484567 Honokiol inhibits bladder tumor growth by suppressing EZH2/miR-143 axis.
26457648 Data show that RAS protein activation was the initiating oncogenic event, with polycomb repressive complex 2 (PRC2) subunits impairment being a secondary event.
26452129 miR-506-EZH2 axis inhibits colon tumor cell proliferation and metastasis by activating/suppressing specific downstream tumor-associated genes and the Wnt/beta-catenin signaling pathway.
26435191 EZH2 serves as an oncogene and is involved in multiple glioma cell processes, including cell cycle, invasion, glioma stem cell maintenance, drug and radiotherapy resistance.
26431491 Data show that basal-like subgroup was enriched for aggressive tumors and somatic mutations in trithorax-group genes and it overexpressed polycomb genes EZH2 and CBX2.
26424790 this study concludes that the epigenetic activity of EZH2 is required for skeletal patterning and development, but EZH2 expression declines during terminal osteoblast differentiation and matrix production.
26416763 Fluid shear stress decreases the expression of the Polycomb methyltransferase EZH2.
26415832 Posttranscriptional silencing of MALAT1 by miR-217 provides a link, through EZH2, between ncRNAs and the EMT and establishes a mechanism for cigarette smoke extract-induced lung carcinogenesis.
26404566 EZH2/miR-622 promotes hepatoma tumorigenesis through CXCR4 activation.
26392259 EZH2 has strong prognostic impact in prostate cancer and might contribute to the development of a fraction of genetically instable and particularly aggressive prostate cancers.
26378045 DKK1 is found to be regulated by NBAT1 in a PRC2 dependent manner, and is responsible for NBAT1's effects in inhibiting migration and invasion of breast cancer cells.
26378043 A xenograft tumor model was used to confirm that EZH2 depletion inhibited HNSCC cell growth and induced tumor cell apoptosis.
26377323 EZH2 expression in salivary gland tumors, similarly to the tumors of other organs is not characteristic for any tumor type, but is a solid marker of the malignant nature of the tumors.
26370511 Chromatin immunoprecipitation confirmed that PARP1 inhibition led to H3K27me3 deposition at EZH2 target genes, which resulted in gene silencing.
26362062 Overexpression of DNMT1 diminishes ursolic acid-reduced EZH2 protein expression.
26360609 Suggest that acquired-resistance to EZH2i may arise in WT and mutant EZH2 patients through a single mutation that remains targetable by second generation EZH2 inhibitors.
26317265 Studies indicate that polycomb repressive complex 2 (EZH2) is overexpressed in multiple tumor types and is often an independent prognostic indicator.
26305882 EZH2 protein expression was associated with a tumor suppressor gene methylator phenotype. DNMT1, DNMT3B, and EZH2 were expressed at significantly higher levels in tumor vs. normal tissues.
26304929 EZH2 has a critical role in the proliferation and viability of melanoma
26280220 specificity of EZH2i toward human RB cells, but not RPE, warrants further in vivo testing in animal models of RB, especially those EZH2i currently in clinical trials for solid tumors and lymphoma
26271144 Review/meta-analysis: over-expression of EZH2 was correlated with a poor breast cancer patient survival.
26268246 Activation of EZH2 and SUZ12 Regulated by E2F1 Predicts the Disease Progression and Aggressive Characteristics of Bladder Cancer
26265454 demonstrated that EZH2 plays a crucial role in tumor growth and distant metastasis in osteosarcoma; its oncogenic role is related to its regulation of the expression of TSSC3
26191190 miR-1297 plays a key role in inhibition of the hepatocellular carcinoma cells proliferation, and enhancing cell apoptosis through targeting EZH2.
26162541 This is the first study to demonstrate a significant association between TNBC risk and the polymorphisms of EZH2 and DNMT1, and our researches indicate that the SNPs of EZH2 and DNMT1 are risk predictors for TNBC.
26111449 CENP-W is a novel kinetochore component that may be involved in the EZH2-mediated silencing machinery.
26104761 EZH2, a component of PRC2 that can affect DNA methylation through association with DNA methyltransferases (DNMTs), did not co-immunoprecipitate with SIRT1, and SIRT1 knockdown did not affect the expression of EZH2 protein
26096306 our study suggests a possible epigenetic mechanism of p16 loss in CDKN2A non-deleted high grade gliomas mediated by strong EZH2 expression
26032517 EZH2 (enhancer of zeste homolog 2) was up-regulated in human oral tongue squamous cell carcinoma tissues and its level positively correlated with level of hMOF.
26004298 Data show a role of EZH2 in the regulation of INK4/ARF expression and senescence procedure in gastric cancer cells, and show that the cellular senescence could just depend on the activation of p15(INK4b)/Rb pathway.
26002960 Data suggest that, during neurogenesis, Mediator complex cyclin-dependent kinases (CDK8, CDK19) interact directly with PRC2 (polycomb repressive complex 2) subunit EZH2 (enhancer of zeste homolog 2), as well as SUZ12 (suppressor of zeste 12 homolog).
25979827 EZH2 and Lat1 expression are co-regulated in models of cancer cell differentiation and co-expression is observed at the invasive front of human lung tumors.
25969142 Ezh2 is required for optimal epidermal cancer stem cells survival and tumor formation.
25955318 EZH2 is involved in cisplatin resistance in ovarian cancer cells by interacting with several genes.
25955299 blockade of CD82 in leukemia cells lowered EZH2 expression via activation of p38 MAPK signaling.
25947258 ANXA6 is a EZH2 target gene involving gastric cellular proliferation.
25938557 EZH2 gene expression in squamous cell differentiation may occur independently on cell proliferation and cell differentiation.
25917318 EZH2 regulates the chromatin structure at the TAGLN promoter through tri-methylation of H3K27, acting as an epigenetic integrator of IL-1beta and TGFbeta2 signaling.
25907866 miR-144 may function as a tumor suppressor by regulating EZH2 expression, and miR-144/EZH2 expression may be a highly sensitive marker for the prognosis in astrocytoma patients.
25890085 DZNep suppressed EZH2/miR-30a,d/KPNB1 signaling.
25877750 In conclusion, YB1 and EZH2 expression was correlated and associated with RCC incidence, tumor stage, grade, metastasis, and survival.
25869101 microRNA-217 inhibits tumor progression and metastasis by downregulating EZH2 and predicts favorable prognosis in gastric cancer.
25833838 Results suggest that the testicular nuclear receptor 4 (TR4) and oncogene EZH2 signaling may play a critical role in the prostate cancer stem/progenitor cell invasion.
25824776 High EZH2 expression is associated with cisplatin-resistance of non-small cell lung and gastric cancer.
25800736 identified that PCAF interacts with and acetylates EZH2 mainly at lysine 348
25767098 STAT3-driven transcription is dependent on dimethylation of K49 by EZH2
25762643 Define Snail and Slug/miR-101/EZH2 pathway as a novel regulatory axis of epithelial-mesenchymal transformation in tongue squamous cell carcinoma.
25746006 High DNA methylation in small cell lung cancer defines distinct disease subtypes and correlates with high expression of EZH2.
25739318 EZH2 as a novel therapeutic target for cervical cancer
25695204 The present study demonstrated an epigenetic link between the activity of the EZH2 methyltransferase at the CLDN23 locus and the expression of CLDN23 in CRC tissue.
25671303 Epigenetic reprogramming by tumor-derived EZH2 gain-of-function mutations promotes aggressive 3D cell morphologies and enhances melanoma tumor growth.
25657202 In ACC, the results also showed strong correlation between the transcriptional repressor EZH2 and TOP2A expression, suggesting a novel role for EZH2 as an additional marker of prognosis.
25651430 High-level EZH2 and H3K27me3 were common in DLBCL independent of cell-of-origin and EZH2 mutation.
25648270 Ezh2 mediated H3K27me3 activity facilitates somatic transition during human pluripotent reprogramming
25644061 SOX4 interacts with EZH2 and HDAC3 to suppress microRNA-31 in invasive esophageal cancer cells.
25633838 EZH2 promotes lung cancer progression via the VEGF-A/AKT signaling pathway.
25614949 Combined immunohistochemical expression of EZH2, H3K4me2, and H3K27me3 might identify cancer cells with potential stem cell properties, particularly at the invasive front, in malignant melanoma.
25614281 EZH2 is both a transcriptional inhibitor and a target gene of miR-101 in HUVECs, and it contributes to some of the miR-101-induced defects of gestational diabetis-HUVECs.
25609585 EZH2-mediated epigenetic repression is highly relevant especially during advanced melanoma progression
25601206 EZH2 protects glioma stem cells from radiation-induced cell death in a MELK/FOXM1-dependent manner
25600645 MALAT1 is transcriptionally activated by c-Fos and interacts with Ezh2.
25595591 EZH2 and DNMT1-mediated epigenetic silencing contributed to the progression of gastric cancer and glioblastoma.
25586788 EZH2 is a novel, independent marker of a poor prognosis in patients with ependymoma.
25578878 The related enzymatic subunits EZH1 and EZH2 undergo an expression switch during blood cell development.
25571919 Upregulation of EZH2, MMP2 and TIMP2 expression was correlated with metastasis of RCC to bone tissues ex vivo and in vitro.
25550361 Mutation in EZH2 gene is associated with secondary acute myeloid leukemia.
25549357 EZH2-silenced cells the signaling activity of the de-repressed ITGalpha2 is able to increase cofilin phosphorylation, which in turn reduces cell migration.
25537508 Data show that sepression of runt-related transcription factor (RUNX1) is important for the growth promotion ability of enhancer of zeste homolog 2 (EZH2) in androgen receptor (AR)-independent cells.
25501205 EZH2 gene silencing effectively suppressed the proliferation, invasion, and migration abilities of human bladder cancer cells, promoting apoptosis.
25500144 CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patient.
25499219 Thus, EZH2 is reciprocally regulated by a novel signaling network consisting of Sp proteins, oncogenic miRs and ZBTB4, and modulation of this gene network is a novel therapeutic approach for treatment of breast cancer and possibly other cancers.
25494962 results indicate that miR-26a exerts growth inhibition in HCC and that its inhibitory effect is mediated briefly by blocking EZH2 expression.
25486432 EZH2-induced downregulation of WIF1 expression may partially regulate Wnt/beta-catenin-dependent crypt hyperplasia in response to citrobacter rodentium infection.
25472588 EZH2 was identified as the functional downstream target of miR-32.
25444902 overexpression of EZH2 is associated with glioblastoma.
25431952 combinatorial silencing along with Ring1b depleted epigenetically modified H2- and H3-histones and inhibited pancreatic cancer cell growth in vitro and in vivo (xenograft model)
25431950 Pharmacologic downregulation suppresses bladder cancer
25428914 HOTAIR promotes cell cycle progression in glioma as a result of the binding of its 5' domain to EZH2
25428391 We for the first time proposed the role interleukin-1beta-mir-101-EZH2 axes in the particle-induced lung cancer
25400745 Suggest that EZH2 plays an important part in the development of multidrug resistance and may represent a novel therapeutic target for multidrug-resistant glioblastoma.
25400732 Suggest that decreased expression of miR-101 might promote metastasis of human esophageal squamous cell carcinoma by inducing accumulation of EZH2 protein.
25355039 Study showed that the expression of COX-2, EZH-2, and p53 may be a predictor for distinguishing cytologically atypical hyperplastic from malignant breast lesions and may be regarded as potential prognostic factor in breast cancer patients.
25350786 IL-6 gene expression was correlated strongly with DNMT1/3A/3B and EZH2 expression, highlighting a potential relationship between IL-6 and important epigenetic regulatory enzymes.
25341040 EZH2 integrates the epigenetic silencing of miR-205 and miR-31 to confer resistance to chemotherapy-induced apoptosis.
25326896 Data show that overall enhancer of zeste 2 (EZH2), embryonic ectoderm development (EED) and suppressor of zeste 12 homolog (SUZ12) expression in the colorectal cancer (CRC) tissues was significantly increased than in the non-cancerous tissue.
25294424 EZH2 expression can be considered a risk factor in glioblastoma multiforme.
25289642 immunostaining for EZH2 and p16INK4a may be useful for differential diagnosis for bile ductular tumors/lesions--{review}
25280519 Overexpression of EZH2 can promote the proliferation of cholangiocarcinoma cells and inhibit their apoptosis.
25275664 Increase of EZH2 and P53 expression is associated with lymph node metastasis in cervical squamous cell carcinoma.
25275047 Activating mutations affecting the NF-kappa B pathway and EZH2-mediated epigenetic regulation are rare events in primary mediastinal large B-cell lymphoma.
25266721 c-Rel regulates Ezh2 expression in lymphocytes and malignant lymphoid cells in a novel transcriptional network
25263318 High level of EZH2 expression is associated with T cell lymphomas.
25262426 advanced NSCLC patients with positive expression of EZH2 exhibited resistance to cisplatin-based chemotherapy. EZH2 may be a predictive and prognostic factor for cisplatin-based therapy response and disease survival in advanced NSCLC.
25260883 miR-101 regulates expression of EZH2 and contributes to progression of and cisplatin resistance in epithelial ovarian cancer
25253781 A687V EZH2 likely increases global H3K27me3 indirectly through increased catalytic activity with H3K27me1 and cells harboring this mutation are highly dependent on EZH2 activity for their survival.
25252918 the existence of an Rb-E2F-Ezh2 axis in bladder whose disruption can promote tumor development.
25243792 found that expression of PcG proteins and H3K27me3 showed prognostic value in our study cohort
25237831 EZH2 inhibited miR-1 transcription via promoter binding activity, leading to enhanced expression of ET-1 which is suppressed by miR-1 targeting of ET-1 3'UTR. Knockdown of EZH2 or overexpression of miR-1 exerted anti-angiogenic effect on NPC cells.
25226601 Aberrant upregulation of 14-3-3sigma and EZH2 expression serves as an inferior prognostic biomarker for hepatocellular carcinoma.
25225797 the KDM2B/let-7b/EZH2 axis is involved in epigenetic regulation in MDS, with direct effects on di- and tri-methylation of H3K27.
25193989 In addition to EZH2 mRNA levels, these results suggest that protein expression of EZH2 can be used as a marker to predict outcome to tamoxifen therapy.
25190211 Results indicate that miR-101 may act as a tumor suppressor in osteosarcoma, as it has a suppressive role in cell migration and invasion by targeting EZH2.
25189741 EZH2 modulates angiogenesis in vitro and in a mouse model of limb ischemia.
25159232 low EZH2 expression might be a useful predictive factor of good tumor response to Neoadjuvant chemoradiotherapy in locally advanced rectal cancer
25154026 show that coupling of EZH@ with the wild-type enzyme is needed to achieve H3K27me3 for several mutants, but that others are capable of achieving H3K27me3 on their own
25131810 EZH2 overexpression is related to a poor prognosis of CLL and could be a useful tool to assess its aggressiveness.
25115397 Data indicate a PRC2 dependent mechanism in ID4 promoter silencing in prostate cancer through recruitment of EZH2 and a corresponding increase in H3K27Me3.
25088689 Data indicate that histone methyltransferase EZH2 is transcriptionally regulated by estradiol in vitro and in vivo.
25085702 These results suggest that miR-214 may induce pathologic cardiac hypertrophy in part by reducing EZH2 messenger RNA levels.
25084021 EZH2-mediated p27Kip1 downregulation is associated with the accelerated cell proliferation and malignant step in pancreatic IPMN.
25077680 EZH2-''induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in epithelial ovarian cancer
25064842 EZH2 can activate MAPK signaling by inhibiting CXXC4 expression.
25055869 EZH2 is recruited to reactivated FMR1 alleles in Fragile X syndrome in response to FMR1 transcription.
25051981 EZH2 correlates with locoregional recurrence in inflammatory breast cancer patients who received radiation treatment.
25047840 Results show that EZH2 is required for increased binding of HP1alpha to H3 tails.
25046371 EZH2 regulates the biology of gliomas by controlling of different pathways; Knockdown of EZH2 alters expression of apoptosis associated-genes and reduces transcription of AXL receptor kinase in gliomas
25043748 EZH2 is not a mandatory H3K27 methyltransferase.
25036033 EZH2 SNP 626 - 394T > C was observed to be associated with susceptibility of esophageal squamous cell carcinoma.
25032847 Hypermethylated HAND1 has a minimum enrichment of EZH2-H3K27me3 in cancer cells.
25025074 Both tumor cells and cancer-associated fibroblasts express EZH2 which then contributes to the malignant grade of serous ovarian tumor
25017995 autoregulatory feedback loop of EZH2/miR-200c/E2F3 served an important function in prostate cancer development
25017254 Study demonstrated that high levels of EZH2 expression predicted poor prognosis in luminal-subtype breast cancer patients. Importantly, EZH2 and HIF-1alpha co-overexpression predicted poorer overall survival.
25007342 lncRNA-EBIC is an oncogenic lncRNA, which can promote tumor cell invasion in cervical cancer by binding to EZH2 and inhibiting E-cadherin expression.
25005166 Upregulated EZH2 expression may contribute to the progression of patients with colorectal cancer through cell proliferation and migration.
24986100 EZH2 correlates positively with VEGF and associates with adverse clinicopathologic characteristics and shorter survival time in clear cell renal cell carcinoma patients
24967960 SPRY4-IT1 repression has an important role in EZH2 oncogenesis.
24953053 Ezh2 loss significantly promotes RUNX1S291fs-induced myelodysplastic syndrome but prevents the transformation of acute myeloid leukaemia.
24928441 EZH2 binds to the promoter of Nrf2, where it increases H3K27me3 and represses Nrf2 expression
24916103 EZH2 occupancy coincides with trimethylation of histone H3 lysine 27 at E2F1 and NOTCH2 promoters.
24878960 overexpression of Ezh2 mRNA with a 3'-untranslated region (3'-UTR) lacking a functional miR-124 binding site, but not with the wild-type Ezh2 3'-UTR, hampered neuronal and promoted astrocyte-specific differentiation
24857928 EZH2 mutation is associated with germinal center lymphomas.
24850841 EZH2 depletion decreases the malignant potential of lung adenocarcinoma and sensitivity of the cells to both platinum-based and VEGFR-2-targeted therapy.
24845612 hyper-expression of the EZH2 correlates closely with the poor prognosis of hepatocellular carcinoma patients
24813658 The expression profiling revealed in the more aggressive diseases (i.e. occurrence of metastases; persistent disease; disease-related death) a significant increase of EZH2 and SMYD3 gene expression.
24807198 Data showed that miR-101 was downregulated and its target EZH2 was upregulated in retinoblastoma tissues and ther expression is significantly associated with adverse clinicopathological and histopathological features.
24804542 TET1 suppresses cancer formation by coupling DNA demethylation with DNA-PK activation of p53 and suppression of oncogenic protein EZH2.
24798718 EZH2 is a prognostic factor for locally advanced/metastatic pancreatic ductal adenocarcinoma, while candidate polymorphisms cannot predict clinical outcome
24771265 Our findings suggest that EZH2-specific microRNA-98 can effectively inhibit cell proliferation in vitro and regulate the pRb-E2F pathway in human ovarian cancer
24745014 This study clearly demonstrates that modulation of EZH2 expression with siRNA affects the cell cycle and the expression levels of p53 and p21, thereby changing cyclin B1 and Cdc2 expression and inducing G2/M arrest.
24739462 study shows IKKalpha restoration via EZH2 suppression induces nasopharyngeal carcinoma differentiation
24738879 EZH2 depletion promoted DOX-induced cell senescence and apoptosis in gastric cancer cells with mutant p53, but had almost no cooperative effect in cells with wild-type p53.
24705718 Our meta-analysis confirmed the view that EZH2 expression might participate in the development of gastric carcinogenesis
24691023 The rs6950683 SNPs of EZH2 might contribute to the prediction of UCC susceptibility. This is the first study to provide insight into risk factors associated with EZH2 variants in carcinogenesis of UCC in Taiwan.
24671995 The epigenetic regulators CDYL and EZH2 to dendrite morphogenesis and might shed new light on our understanding of the regulation of the neurodevelopment.
24658854 study indicate that miR-124 can suppress gastric cancer cell growth by directly targeting the EZH2 gene and sensitize the treatment effect of 5-FU.
24652950 G9a- and EZH2-mediated histone hypermethylation.
24634383 EZH2 mutation is associated with follicular lymphomas.
24612432 EZH2 may contribute to RCC progression and is a potential therapeutic target for advanced Renal Cell Carcinoma (RCC).
24612037 EZH2 plays a crucial role to maintain mixed lineage leukemia fusion leukemia through inhibition of p16.
24608043 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, beta-catenin and EZH2.
24588771 Data suggest that EZH2 depletion promotes the progression of senescence by mediating the activation of tumor suppressor genes p21 and p16.
24516139 EZH2 acts as an activator of the NOTCH1 promoter and signaling to expand the stem cell pool, leading to accelerated breast cancer initiation and growth.
24501407 Short-chain fatty acids from periodontal pathogens suppress EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24499724 MYC, in concert with EZH2, epigenetically attenuates MST1 expression and suggest that the loss of MST1/Hippo functions is critical for the MYC or EZH2 mediation of cancer cell survival.
24488618 EZH2 polymorphisms are associated with colorectal cancer.
24487593 Immunostaining for EZH2 and p16(INK4a) may be useful for differential diagnosis among cholangiolocellular carcinomas, bile duct adenomas, and ductular reactions.
24474760 study not only uncovers a functional posttranslational modification of EZH2 but also reveals a unique epigenetic role of OGT in regulating histone methylation
24469045 By challenging the role of EZH2 in aberrant gene silencing in cancer, these findings have therapeutical implications, notably for the choice of epigenetic drugs for tumors with multiple regional epigenetic alterations.
24469040 beta-TrCP has an important role in controlling H3K27 trimethylation activity and lymphoma pathogenesis by targeting EZH2 for degradation.
24446035 high EZH2 expression is significantly associated with adverse prognostic factors and shorter metastasis-free and cancer-specific survival in patients with upper urinary tract carcinoma.
24429498 Loss of EZH2 is associated with myeloid neoplasms.
24424512 EZH2 acts as an oncogene and plays an important role in oral squamous cell carcinoma metastasis and inhibition of apoptosis.
24413452 EZH2 expression increases incrementally from normal skin to actinic keratosis and further to squamous cell carcinoma, suggesting a role for EZH2 in the progression and differentiation of SCC.
24406044 MiR-138 is a tumor-suppressor miRNA in ccRCC that induces SN-12 cell senescence by downregulating EZH2 expression and upregulating P16 expression.
24403021 the interaction of lncRNAs with signaling pathways in gliomas is discussed systematically, with particular emphasis on the interaction of lncRNAs with EZH2
24389103 Ezh2 and G9a/GLP share an important number of common genomic targets, encoding developmental and neuronal regulators.
24367637 disease-associated mutations and putative mechanism of autoinhibition revealed by X-ray crystallographic analysis of the EZH2-SET domain
24367611 protein interactions within the PRC2 complex modulate the trajectory of the post-SET and I-SET domains of EZH2 in favor of a catalytically competent conformation
24351808 The drop in EZH2 is inversely correlated with: (i) lipid accumulation; (ii) the expression of pro-inflammatory markers including TNF-alpha and TGF-beta; and (iii) the expression of miR-200b and miR-155.
24349473 By integrating our WES and CN data we identified three mutated putative candidate genes targeted by 7q deletions (CUL1, EZH2 and FLNC), with FLNC positioned within the well-characterized 7q minimally deleted region.
24346863 High EZH2 expression is associated with colorectal cancer.
24344012 In aneuploid tumors, EZH2 expression and paxillin expression correlate with more aggressive phenotype of breast cancer.
24339737 Knockdown of EZH2 increased the ubiquitination level of H2BK120.
24335192 The expression of BRCA1 is modulated by EZH2 in epithelial ovarian cancer and BRCA1 is required for the effects of EZH2 downregulation on biological behaviors of tumor cells.
24320048 EZH2-EED is necessary and sufficient for binding to the lncRNA HOTAIR.
24312307 prognostic value of EZH2 expression and activity in renal cell carcinoma
24292603 To our knowledge EZH2 gene amplification presents the first genetic aberration common to parathyroid adenomas, secondary hyperplastic parathyroid glands, and parathyroid carcinomas.
24289559 Overexpression of EZH2 attenuated the Triptolide induced cell growth inhibition.
24266940 High EZH2 expression was associated with a high nuclear grade in invasive lobular carcinoma of the breast.
24218139 In a patient cohort of myelodysplastic disorders, EZH2 mutations were found and often coincided with tet methylcytosine dioxygenase 2 (TET2) mutations.
24214728 As mutation testing becomes increasingly accessible and larger numbers of EZH2 mutation-positive individuals are identified, knowledge of the clinical spectrum and prognostic implications of EZH2 mutations should improve.
24213577 EZH2 is a key factor in the proliferation and survival of PAX3-FOXO1 alveolar RMS cells working, at least in part, by repressing FBXO32
24212330 Cancer-associated fibroblasts enhance the migration ability of ovarian cancer cells partly by increasing EZH2 expression.
24211739 There was a negative correlation between expression levels of miR-101 and EZH2
24139839 time that the combination of Bmi1 and EZH2 overexpression may be a highly sensitive marker for the prognosis in glioma patients.
24132643 we report that the EZH2-miR-30d-KPNB1 signalling pathway is critical for malignant peripheral nerve sheath tumour cell survival in vitro and tumourigenicity in vivo
24132606 EZH2 accelerates cancer cell migration, in part, via the repression of TIMP-3 expression.
24123378 Both Ezh2 and Kdm6a were shown to affect expression of master regulatory genes involved in adipogenesis and osteogenesis.
24122997 P53 alteration may be involved in dysregulated EZH2 expression, and aberrant expression of EZH2 may play a role in carcinogenesis of oral squamous cell carcinoma.
24107828 EZH2 is involved in the long-term silencing of HOX genes in MCL, and allude to its potential as a therapeutic target with clinical impact.
24097870 In lung, EZH2 expression is involved in early pathogenesis of squamous cell carcinomas.
24097338 review examines the role of EZH2 in normal and malignant hematopoiesis and recent developments in harnessing the therapeutic potential of EZH2 inhibition
24079759 EZH2 expression is associated with increased metastatic potential and a worse clinical outcome.
24079712 EZH2 and HDAC4 represent mutually exclusive epigenetic pathways across human cancers
24077223 These findings support a model in which PRC2's promiscuous binding to RNA transcripts allows it to scan for target genes that have escaped repression, thus leading to maintenance of the repressed state.
24074410 Downregulation of mutant p53 with concomitant enhanced expression of p21(waf1/cip1) and its transcriptional trans-activators may contribute toward EZH2-mediated suppression of pancreatic ductal adenocarcinoma.
24055345 Data indicate that PAF-EZH2-beta-catenin complex hyperactivates Wnt signaling.
24052547 Data suggest that the high incidence of EZH2 mutations in follicular lymphoma (FL) and their stability during disease progression makes FL an appropriate disease to evaluate EZH2 targeted therapy.
24040354 rs6950683 and rs3757441 polymorphic genotypes of EZH2 might contribute to the prediction of susceptibility to and pathological development of hepatocellular carcinoma
24032713 In prostate epithelial cells, overexpression of DeltaS2 PRLR increased the levels of EZH2 methyltransferase mRNA and protein, induced EZH2 methyltransferase recruitment to chromatin, leading to decreased expression of the p53 gene.
24018208 these data imply that Sp1 and EZH2 may activate LMX1A expression upon oncogenic stress during cervical cancer development.
23967231 Genomic deregulation of the E2F/Rb pathway leads to activation of the oncogene EZH2 in small cell lung cancer.
23962556 Data indicate that miR-101 overexpression downregulates microphthalmia-associated transcription factor (MITF) and enhancer of zeste homolog 2 (EZH2) protein in melanoma cells.
23949225 CXXC4 is a novel potential tumor suppressor directly regulated by EZH2, and its expression is a significant prognosis factor for patients with early stages of gastric cancer.
23948956 in aggressive lymphoma variants, Ezh2 is strongly expressed and polycomb repressive complex PRC1.4 dominates over PRC1.2.
23918806 Data indicate a critical role played by EZH2 in determining the cancer phenotype.
23907130 Therapeutic targeting of EZH2 activity might serve as a strategy for improving conventional chemotherapy in a given malignancy.
23893242 SAFB1 formed a complex with the histone methyltransferase EZH2.
23887863 EZH2 upregulation correlated with lymph node metastasis in cholangiocarcinoma.
23874688 GSK3beta inactivation may account for EZH2 overexpression and subsequent tumour progression, and this mechanism might be a potential target for nasopharyngeal carcinoma therapy.
23857401 findings present evidence for the role of EZH2 in the regulation of cell cycle and apoptosis, providing a biological mechanism to explain the tumorigenicity of EZH2 in small-cell lung cancers
23815091 MiR-144 downregulation relieves miR-144-mediated repression of EZH2, which results in activation of Wnt/b-catenin signaling and subsequent cell proliferation.
23803132 there was no evidence of EZH2 mutations in the 55 cases of chronic myeloid leukemia Blast Crisis analyzed. the EZH2 mutations might not involved in the leukemogenesis of CML and the progression from CMLCP to CML-BC.
23792601 EZH2 Overexpression is associated with endometrial Cancer.
23759596 ALDH1 within the DCIS lesion can add to the prognostic significance of EZH2, particularly in the context of risk of development of invasive disease.
23759589 In EZH2 wild-type solid tumors, the ECM tumor microenvironment plays an important role in determining sensitivity to EZH2 inhibition.
23739676 EZH2 is essential for prostate cancer stem cell growth.
23707559 EZH2-mediated signal loop, EZH2-CDK4/6-pRb-E2F1, is probably involved in GBM tumorigenicity, and this loop can be blocked by miRNA-138
23684459 EZH2 binds to and methylates STAT3, leading to enhanced STAT3 activity by increased tyrosine phosphorylation of STAT3.
23677067 FEZF2 acted as a histone deacetylase-associated repressor downregulating multiple oncogenes including EZH2 and MDM2, through direct binding to their promoters.
23636867 As a solitary marker, EZH2 exhibited a sensitivity of 90% and a specificity of 100% (P < 0.0001). EZH2 functioned as a unique and accurate marker of malignancy in this series of effusions.
23636686 This review therefore provides a comprehensive overview of EZH2 in the context of prostate cancer.
23624935 BRCA1 deficiency blocks embryonic stem (ES) cell differentiation and enhances breast cancer migration and invasion in an EZH2-dependent manner.
23613835 these results showed EZH2 mutation in de novo acute myeloid leukemia as a recurrent genetic abnormality to be associated with lower blast percentage in bone marrow and -7/del(7q).
23603558 EZH2 has a role in regulation of p21 and mutant p53 involved in growth of ovarian cancer
23592277 NSD1 mutations that cause Sotos syndrome are loss-of-function, primarily truncating mutations or missense mutations at key residues in functional domains. EZH2 mutations that cause Weaver syndrome are primarily missense variants
23562851 EZH2 is highly expressed in the human hepatic multidrug-resistant cancer cell line Bel/Fu
23557329 miR-101 and Ezh2 are key players in UVB-induced senescence of human diploid fibroblasts.
23539298 EZH2 role in breast cancer metastasis
23538750 findings represent a novel promising approach for silencing MYC-miRNA-EZH2 amplification loop for combinatorial therapy of aggressive B-cell lymphomas
23529930 Our study uncovers an oncogenic role of EZH2 independent of its methyltransferase activity in natural killer T-cell lymphoma.
23526793 Smurf2-mediated degradation of EZH2 enhances neuron differentiation and improves functional recovery after ischaemic stroke
23523787 EZH2 can modulate the transcription of basally expressed hMLH1 (human mutL homolog 1 gene) via a non-DNA-methylation-dependent pathway, but it has no effect on hMLH1 silencing that is mediated by DNA hypermethylation.
23486531 EZH2 mutations were characterized by decreased H3K27 trimethylation and increased chromatin relaxation at specific gene loci accompanied by higher transcriptional activity
23438432 this study demonstrated that ANCR is associated with enhancer of zeste homolog 2 (EZH2) and that this association results in the inhibition of both Runx2 expression and subsequent osteoblast differentiation.
23421437 These results revealed a novel therapeutic mechanism underlying sorafenib treatment in suppressing hepatoma growth and survival by accelerating EZH2 degradation.
23395645 EZH2 is up-regulated in PDAC samples from patients and silences miR-218. MicroRNA-218 prevents proliferation of PDAC cells in culture, and tumor growth and metastasis in nude mice.
23361872 EZH2 point mutation is associated with B-cell non-Hodgkin lymphomas.
23354591 Long non-coding RNA H19 is associated with enhancer of zeste homolog 2 (EZH2)
23343715 The knockdown of EZH2 phenocopied the tumor suppressive effects of miR-138 in cell models, whereas ectopic expression of EZH2 rescued the suppressive effects of miR-138.
23300840 EZH2 mRNA levels may serve as a prognostic predictor for patients with non-small cell lung cancer.
23294722 Both EZH2 and RUNX3 may play important roles in the development and progression of RCC, and the detection on EZH2 and RUNX3 expressions will be helpful for early diagnosis and prognosis prediction of RCC.
23291714 EZH2 plays a role in the development of multidrug resistance in hepatocellular carcinoma cells.
23289480 EZH2 is overexpressed in nasopharyngeal cancer and reduces expression of p16(INK4a) by influencing DNA methylation.
23283488 EZH2 as a critical mediator of cancer stem cell maintenance in breast and pancreatic tumor cell lines.
23239736 the oncogenic function of EZH2 in cells of castration-resistant prostate cancer is independent of its role as a transcriptional repressor. Instead, it involves the ability of EZH2 to act as a coactivator for critical transcription factors including the androgen receptor.
23228130 The complex PRAME/EZH2 is able to repress TRAIL expression, in a cancer-specific manner; inhibition of PRAME/EZH2 releases apoptosis-mediating TRAIL. (Review)
23190500 Overexpression of EZH2 is associated with atypical rhabdoid teratoid tumor.
23163606 Overexpression of EZH2 may be associated with malignant behaviour in intraductal papillary neoplasm of the bile duct in parallel with up-regulated MUC1 expression and down-regulated MUC6 expression.
23159737 The EZH2-MMSET-histone methylase axis coordinately functions as a master regulator of transcriptional repression, activation, and oncogenesis.
23135913 MYC acts via the PTEN tumor suppressor to elicit autoregulation and genome-wide gene repression by activation of the Ezh2 methyltransferase.
23121604 EZH2 is a useful prognostic marker for aggressive behavior of clearb cell renal carcinoma and may be applicable as a therapeutic target molecule.
23116973 Integrin alpha2 is identified to be a novel EZH2 target by chromatin immunoprecipitation and short hairpin RNA analysis.
23099237 EZH2 mutations might predict an increased risk of transformation to acute myeloid leukemia.
23095338 Report association of EZH2 staining with actinic keratosis and squamous cell carcinoma of the skin.
23079660 demonstrate that miR-29 is repressed by MYC through a corepressor complex with HDAC3 and EZH2
23077658 Collectively these data suggest that EZH2 drives glioma invasiveness via transcriptional control of AXL independent of histone or DNA methylation.
23063525 The enhancer of zeste homolog 2 (EZH2) methyltransferase has distinct substrate specificities for histone H3K27 and nonhistones exemplified by an orphan nuclear receptor, RORalpha.
23001607 EZH2 has roles in cancer through its interactions with non-coding RNA [review]
22994729 The average overall survival and disease-free survival of patients with both EZH2 and H3K27me3 expression was 18.8 and 12.9 months, respectively.
22992977 study demonstrated that the Ezh2 gene is highly expressed in glioma cells and the downregulation of Ezh2 expression induces apoptosis through the mitochondrial pathway by regulating the Bcl-2/Bax family in glioma cells
22986524 Our findings reveal a novel role for EZH2 in controlling basal-like breast cancer differentiation state and intra-tumoral cell composition.
22972404 results demonstrate EZH2 expression in nasopharyngeal carcinoma is directly and negatively regulated by let-7a; let-7a is downregulated in nasopharyngeal carcinoma cells resulting in increased EZH2 expression leading to enhanced proliferation and inhibition of apoptosis
22956625 data suggest that EZH2 is overexpressed in B-ALL and promotes the progression of B-ALL by directly mediating the inactivation of tumor suppressor genes p21 and PTEN
22948084 miR-31 overexpression resulted in down-regulation of EZH2 and a de-repression of its target gene rap1GAP; increased expression of EZH2 was associated with melanoma progression and overall patient survival.
22930729 Authors propose the hypermethylation of miR-26a as an alternative pathway of ERG rearrangement-independent EZH2 activation.
22914328 Interaction of EZH2 with LIMK1 changed the activity of cofilin (a downstream target of LIMK1) towards actin filaments, thereby leading to lower filamentous actin content within these cells.
22871469 Overexpression of EZH2, FAK and pFAK correlates with well established pathologic risk factors and may predict a more aggressive biologic behavior in endometrial carcinoma.
22869879 In patients with myelodysplatic syndrome, EZH2 mutation status combinined with the Lower-Risk Prognostic Scoring System identifies 29% of patients with a worse-than-expected prognosis.
22867052 MicroRNA-98 and microRNA-214 post-transcriptionally regulate enhancer of zeste homolog 2 and inhibit migration and invasion in human esophageal squamous cell carcinoma.
22855181 EZH2 may play an important role in the progression and metastasis of lung cancer
22850114 EZH2 SET domain point mutation A687V, occurring in 1-2% of lymphoma patients, is a gain-of-function mutation that greatly enhances its ability to perform dimethylation relative to wild-type EZH2 and is equally proficient at catalyzing trimethylation.
22809481 EZH2 is a sensitive marker of hepatocellular carcinoma, but its specificity is very low
22800347 EZH2 significantly enhanced the proliferation and invasion of nasopharyngeal carcinoma cells in vitro.
22766604 Both Bmi1 and EZH2, not each alone, could be potent candidates of new target therapy in esophageal squamous cell carcinoma.
22766277 High expression of EZH2 was associated with poor distant disease-free survival whereas high expression of H3K27me3 was associated with better survival in patients with in breast tumor.
22705924 Increased EZH2 expression associates with a more undifferentiated and aggressive state in urothelial carcinoma.
22696229 Studies indicate that DAB2IP and EZH2 are inversely expressed in medulloblastoma.
22677129 Ezh2 inhibits differentiation programs in leukemic stem cells, thereby augmenting their leukemogenic activity.
22675170 Data indicate in primary gastric cancers, EZH2 expression was negatively correlated with p53 pathway activation, suggesting that higher levels of EZH2 may repress p53 activity.
22659877 Overexpression of EZH2-bound intronic RNA for the H3K4 methyltransferase gene SMYD3 is concomitant with an increase in EZH2 occupancy throughout the corresponding genomic fragment and is sufficient to reduce levels of the endogenous transcript and protein
22609199 these results show nuclear EZH2 as a prognostic marker of worse survival in human RCC, and identify miR-101 as a negative regulator of EZH2 expression and renal cancer cell proliferation.
22593192 Taken together, our findings indicate that KSHV regulates the host epigenetic modifier EZH2 to promote angiogenesis.
22588437 results support the possible involvement of EZH2 mRNA overexpression in the development of prostate inflammation, and its new regulatory role in suppressing the expression of some inflammatory network genes
22563434 EZH2 knockdown decreases CIITApIV histone H3K27 trimethylation.
22552406 EZH2 contributes to the progression of lung adenocarcinoma
22544210 High EZH2 expression was noted in 120 of 140 triple negative breast cancers and was not associated with other variables.
22527102 detailed histological characterization of a large cohort of invasive breast carcinomas from Ghana; a high frequency of basal-like, high grade tumors with squamous differentiation was found; EZH2 overexpression occurs in 42 % of the invasive carcinomas and is associated with basal-like features
22505648 data implicate EZH2 in the regulation of RKIP transcription, suggesting a potential mechanism by which EZH2 promotes tumor progression and metastasis
22469510 miR-26a expression inhibited the expression of enhancer of zeste homolog 2 and transactivated downstream target genes, which suggests that EZH2 is a potential target of miR-26a; miR-26a plays an important role as an anti-oncogene in the molecular mechanism of lung cancer
22465358 Data show that pEZH2 was found concentrated in the liver Mallory-Denk bodies (MDB) of alcoholic hepatitis or hepatocellular carcinoma.
22450781 Deletions and/or microdeletions at both miR-101 genomic loci cause mature miR-101 down-regulation, subsequent EZH2 over-expression and E-cadherin dysfunction, specifically in intestinal-type gastric carcinoma.
22442719 the loss of let-7 mediated increased expression of EZH2 contributes to PCa aggressiveness, which could be attenuated by BR-DIM treatment, and thus BR-DIM is likely to have clinical impact.
22436627 Our results show that high enhancer of zeste homolog 2 expression is significantly associated with triple-negative breast cancer and decreased survival
22431509 studies document that deregulation of EZH2 and associated genes leads to the development of mouse, and likely human adult T-cell acute leukemia
22383679 EZH2 polymorphism and benefit from bevacizumab in colorectal cancer.
22370893 Our study demonstrated that EZH2 epigenetically silenced multiple miRNAs that negatively regulate hepatocellular carcinoma metastasis.
22349693 The emerging picture presents PRC2 as a cooperative multipart machine, intricately outfitted to sense and respond to the local chromatin environment and other cues[review]
22323599 Structural modeling of wild type and mutant EZH2 suggested that the A677G mutation acquires the ability to methylate H3K27me2.
22308284 Genetic defects in PRC2 components other than EZH2 are not common in myeloid malignancies.
22287205 High EZH2 expression is associated with medulloblastoma.
22272343 Results suggest that EZH2-mediated transcriptional repression of TIMP3 directly leads to activation of MMP-9.
22266912 EZH2 mutation is associated with childhood acute myeloid leukemia.
22237151 study reports presence of loss-of-function mutations and deletions of the EZH2 and SUZ12 genes, which encode components of the Polycomb repressive complex 2 (PRC2), in 25% of T cell acute lymphoblastic leukemias; study suggesst tumor suppressor role for PRC2 in leukemia and suggest a gnized dynamic interplay between oncogenic NOTCH1 and PRC2
22235851 EZH2 mutations seem to be associated with PICALM-MLLT10 positive acute leukaemia.
22228224 EZH2 variants were significantly associated with gastric cancer risk.
22222375 These results strongly suggested that the oncogenic RAS upregulates EZH2 through MEK-ERK signaling, resulted in downregulation of tumor suppressors including RUNX3 in pancreatic carcinogenesis.
22211105 The contribution of EZH2 and the PRC2 complex in controlling the H3K27 methylation status and subsequent consequences on genomic instability and the cell cycle in breast cancer cells is discussed. [review]
22194861 EZH2 mutations constitute an additional genetic "hit" in many BCL2-rearranged germinal center B cell lymphomas.
22190405 Our data establish EZH2 mutations as the cause of Weaver syndrome and provide further links between histone modifications and regulation of human growth.
22187039 address the current understanding of the mechanisms underlying EZH2 regulation alongside the function of EZH2 gene targets that are involved in cancer progression
22177091 These data showed that mutations in EZH2 cause Weaver syndrome.
22161744 EZH2 plays major roles in the progression of oral tongue squamous cell carcinoma.
22068036 determined that the tumor suppressors CLU, NGFR, and RUNX3 were also directly repressed by EZH2 like CASZ1 in NB cells
21989926 The current results indicated that EZH2 is an independent prognostic indicator for patients with HNSCC.
21941025 The results implicate EZH2-driven mechanisms by which Myc may stimulate prostate tumor initiation and disease progression.
21932133 EZH2 expression was significantly higher in malignant than benign intraductal papillary mucinous neoplasms of the pancreas (IPMN), indicating that overexpression of EZH2 could promote malignant transformation of IPMN.
21926398 An EZH2 SNP may be useful to predict clinical outcome in metastatic colorectal cancer patients.
21921784 Malignant rhabdoid tumors express many stem cell-associated transcription factors, which may be regulated by the expression of EZH2 and the Id family of proteins.
21921040 study concludes that EZH2 mutations are independently associated with shorter survival in patients with primary myelofibrosis
21914347 Abnormal expression of Ezh2, Runx3 and caspase-3 is associated with the development and progression of endometrioid adenocarcinoma.
21903722 loss of EZH2-dependent methyltransferase activity in the endometrium is integral to the process of chromatin remodeling that enables the transition from a proliferative to a decidual phenotype in response to differentiation cues.
21892211 KLF2 repression has an important role in EZH2 oncogenesis
21884980 EZH2 functions as a double-facet molecule in breast cancers, either as a transcriptional activator or repressor of NF-kappaB targets, depending on the cellular context
21865393 Correlating with the loss of H3K27me3, human papillomavirus 16 E6/E7-expressing cells exhibited derepression of specific EZH2-, KMD6A-, and BMI1-targeted HOX genes.
21856302 Data demonstrate that while the Y641C mutation of EZH2 ablates enzymatic activity against unmethylated and monomethylated H3K27, it is superior to wild-type in catalyzing the formation of trimethylated H3K27 from the dimethylated precursor.
21837672 EZH2 promotes progression and invasion of nonsmall cell lung cancer (NSCLC), and its expression is a novel prognostic biomarker in NSCLC.
21828135 Novel UTX, DNMT3A, and EZH2 mutations were found in 8%, 10%, and 5.5% of patients with chronic myelomonocytic leukemia.
21769904 Long noncoding RNA-HEIH was associated with enhancer of zeste homolog 2 (EZH2) and that was required for the repression of EZH2 target genes in hepatocellular carcinoma.
21765901 A possible role of EZH2 for the growth control of colon cancer cells, was investigated.
21761357 Developmental programming of EZH2 is a novel mechanism by which in utero exposure to endocrine disruptors leads to epigenetic regulation of the mammary gland.
21719208 overexpression of EZH2 and loss of PTEN expression might be closely related to the carcinogenesis, progression, clinical biological behavior, and prognosis of gallbladder adenocarcinoma.
21715480 Knockdown of EZH2, the enzyme which is required for trimethyl histone lysine 27 (H3K27me3) synthesis induced up to 40% of the latent HIV proviruses.
21713757 Results indicate that EZH2 expression status may be used to identify a subset of patients with inflammatory breast cancer who have a relatively worse prognosis.
21703114 Depletion of SIRT1 increases the protein stability of EZH2. The regulation of EZH2 protein level by SIRT1 affects the repressive effects of EZH2 on the target gene expression.
21697275 High EZH2 is associated with oral cancer development in patients with oral leukoplakia.
21690062 The overexpression of EZH2 is correlated to nasopharyngeal carcinoma progression and poor prognosis.
21685935 Data suggest a critical role of EZH2 in the control of cell invasionand/or metastasis by forming a co-repressor complex with HDAC1/HDAC2/Snail to repress E-cadherin.
21659531 a novel function for CDK1-mediated Ezh2 phosphorylation and provide a mechanism by which Ezh2 protein levels can be regulated in cells.
21629038 associated with tumor cell proliferation and invasion in cervical cancer
21614903 High intensity staining for EZH2 expression was associated with higher histologic grade, negative estrogen and progestin receptor expression and positive Ki-67 expression in breast carcinomas.
21614565 EZH2 may be a useful biomarker of long-term metastatic risk in women with familial early-stage breast cancer.
21609503 In this review, an overview of the recently reported functions of EZH2 in soft tissue sarcomas is given and the hypothesis that its expression might be involved in soft tissue sarcomagenesis is discussed.
21572997 DNA methyltransferase controls stem cell aging by regulating BMI1 and EZH2 through microRNAs.(
21546904 EZH2 regulates DNA damage response in p53 wild-type cells mainly through transcriptional repression of FBXO32, which binds to and directs p21 for proteasome-mediated degradation.
21539681 study finds EZH2 to be highly overexpressed in lung and other cancers, and show that EZH2 is integral to proliferation in cancer cells
21532618 A polycomb-mediated repression of rap1GAP was demonstrated that involves EZH2, a histone methyltransferase in head and neck cancers. It was also shown that the loss of miR-101 expression correlates with EZH2 upregulation and rap1GAP downregulation.
21515604 These data strongly suggest that the chronic inflammatory environment of the RA joint induces EZH2 and thus might cause changes in the epigenetic programmes of SF.
21512140 Data indicate that EZH2-mediated epigenetic silencing contributes to constitutive activation of Wnt/beta-catenin signaling and consequential proliferation of HCC cells.
21499305 findings demonstrated that MEK-ERK1/2-Elk-1 pathway leads to EZH2 overexpression in breast cancer
21455215 6 novel mutations in EZH2 in the primary myelofibrosis & CMML samples in this cohort. All of these mutations were heterozygous mutations, which resulted in a premature stop codon & were distributed along multiple exons.
21406404 Results show the mechanism by which EZH2 regulates BRCA1 expression and genomic stability mediated by the PI3K/Akt-1 pathway.
21399658 Data show that, in response to IFNalpha, STAT2 is recruited onto the endogenous P2p73 promoter together with the polycomb group protein Ezh2.
21399615 EZH2 and ALDH-1 mark breast epithelium at risk for breast cancer development.
21396836 Data indicate that elevated polycomb group protein enhancer of zest homolog 2 (EZH2) protein levels are associated with more aggressive urothelial carcinoma (UC), and may therefore serve as a useful biomarker for UC.
21383005 these findings describe a novel mechanism whereby EZH2 activation during tumor progression represses p21, leading to suppression of cellular senescence and enhanced tumorigenicity.
21368858 The enhancer of zeste homolog 2 protein is associated with a higher risk of relapse in nasopharyngeal carcinoma patients.
21367748 Aberrations of EZH2 in cancer.
21339759 Mutations in the EZH2 gene is associated with chronic myelomonocytic leukemia.
21339190 Elevated EZH2 expression is associated with glioma.
21325804 The aim of this study was to investigate the correlation between the expression of EZH 2 with p53 and Ki-67 expression and other clinicopathological parameters in primary breast carcinomas
21321380 EZH2 has a versatile function in glioblastoma progression and that its overexpression is at least partly due to decreased miR-101 expression.
21307773 Studies indicate that additional mutations in genes which appear to affect the epigenome of MPN patients have been discovered including mutations in TET2, IDH1/ 2, EZH2, and ASXL1.
21297974 by identifying a pro-angiogenic VEGF/miR-101/EZH2 axis in endothelial cells we provide evidence for a functional link between growth factor-mediated signaling, post-transcriptional silencing, and histone-methylation in the angiogenesis process
21292308 Enhancer of zeste homolog 2 may play an important role in the regulation of biologic behavior of high-grade neuroendocrine carcinomas.
21289264 EZH2 is specifically overexpressed in ATC, and it directly contributes to transcriptional silencing of PAX8 gene and anaplastic thyroid carcinoma differentiation.
21233829 EZH2 Y641 mutations are not associated with follicular lymphoma
21232178 SATB1 is a bona fide EZH2 target gene in HeLa cells and the repression of SATB1 by EZH2 may be mediated by trimethylation modification on H3K
21228036 Data show there was an inverse correlation between the expression level of EZH2 and that of miR-101 or miR-128a, suggesting that the altered expression of the latter miRNAs accounts for the overexpression of the former.
21216957 EZH2 regulates neuronal differentiation of mesenchymal stem cells through PIP5K1C-dependent calcium signaling.
21215703 EZH2 expression-mediated downregulation of DNA damage repair leads to accumulation of recurrent RAF1 gene amplification in breast tumor initiating cells (BTICs), which activates p-ERK-beta-catenin signaling to promote BTIC expansion.
21205084 EZH2 gene acts as an oncogene in tumorigenesis of ovarian cancer with the possible mechanism to suppress the anti-oncogene p57.
21199804 RalA interaction with the Exo84 but not Sec5 exocyst component was necessary for supporting anchorage-independent growth, whereas RalB interaction with Sec5 but not Exo84 was necessary for inhibition of anchorage-independent growth
21190999 a disease-associated gain-of-function mutation in a histone methyltransferase, whereby somatic EZH2 Y641 mutations in lymphoma act dominantly to increase, rather than decrease, histone methylation
21165554 High expression of EZH2 is associated with P53 alteration and results in squamous cell carcinoma of the esophagus.
21131960 Findings define a signalling link between CDK1 and EZH2 that may have an important role in diverse biological processes, including cancer-cell invasion and osteogenic differentiation of mesenchymal stem cells.
21125401 Overexpression of the EZH2, RING1, and BMI1 genes is common in MDS and indicate poor prognosis. The products of these genes might participate in epigenetic regulation of Myelodysplastic syndromes.
21116854 These results suggest loss of FOXO1 expression and elevated AURKA/B and EZH2 expression in lesional psoriatic tissues have potential contribution to the development of psoriasis.
21115743 EZH2 is frequently overexpressed in human EOC cells and its overexpression promotes the proliferation and invasion of human EOC cells
21087793 EZH2 mutations are not associated with splenic b-cell marginal zone lymphoma.
21078963 the malignant phenotype of disease requires the combined activities of a H3K27 monomethylating enzyme (PRC2 containing WT EZH2 or EZH1) together with the mutant PRC2s for augmented conversion of H3K27 to the trimethylated form
20952513 miR-26a functionally antagonizes human breast carcinogenesis by targeting MTDH and EZH2.
20946108 The data suggest that EZH2 plays a role in glioma progression
20935635 Blockage of Thr 350 phosphorylation not only diminishes the global effect of EZH2 on gene silencing, it also mitigates EZH2-mediated cell proliferation and migration.
20920340 Enhancer of zeste homolog 2 (EZH2) has a role in progression of renal cell carcinoma
20864510 Data show that that ANCCA is crucial for proliferation and survival of triple-negative/basal-like cancer cells and that it controls the expression of B-Myb and histone methyltransferase EZH2.
20863566 Observational study of gene-disease association. (HuGE Navigator)
20858097 Somatic mutations altering Tyr641 of EZH2 are rare in primary central nervous system lymphoma.
20736451 EZH2 is involved in regulating a specific epigenetic program in normal germinal centers, including silencing of antiproliferative genes, which may contribute to the malignant transformation of GC B cells into DLBCLs
20724984 Mutations in EZH2 is associated with myeloid malignancies.
20686362 Data suggest that EZH2 could be a potential novel epigenetic target to overcome drug resistance.
20684863 Knock-down of EZH2 inhibited liver metastasis of pancreatic cancer in vivo. EZH2 has a crucial role in tumor growth and liver metastasis of pancreatic cancer.
20616235 findings show that the lincRNA HOTAIR serves as a scaffold for at least two distinct histone modification complexes; A 5' domain of HOTAIR binds polycomb repressive complex 2 (PRC2), whereas a 3' domain of HOTAIR binds the LSD1/CoREST/REST complex
20601954 study reports that EZH2, located at 7q36.1, is frequently targeted in myelodysplastic syndromes (MDS); as EZH2 functions as a histone methyltransferase, abnormal histone modification may contribute to epigenetic deregulation in MDS
20601953 homozygous EZH2 mutations found in individuals with 7q acquired uniparental disomy; monoallelic or biallelic mutations found in myeloid disorders; mutations resulted in premature chain termination or abrogation of histone methyltransferase activity
20573371 Our study suggests that E-cadherin down-regulation may lead to enhancer of zeste homologue 2-mediated invasion and metastasis.
20569692 required for the direct conversion of differentiated cells toward pluripotency
20564407 High EZH2 expression was correlated with tumor aggressiveness
20480530 EZH2 and STAT6 expressions have significant values in distinguishing clinical stages of colorectal cancer and predicting the prognosis of the patients.
20479932 The prostate-specific tumor suppressor gene Nkx3.1 was controlled by ERG and ESE3 both directly and through induction of EZH2.
20478527 found that ERG disrupts androgen receptor (AR) signaling by inhibiting AR expression, binding to and inhibiting AR activity at gene-specific loci, and inducing repressive epigenetic programs via direct activation of the H3K27 methyltransferase EZH2
20478051 miR-101 targets Ezh2 and decreases the invasiveness of prostate cancer cells
20402834 PcG protein EZH2 plays an important role in the multi-step process of intestinal-type gastric carcinogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20369694 The over-expressions of the EZH2 protein and EZH2 mRNA may play an important role in the pathogenesis and progression of prostate cancer.
20306127 study concludes EZH2 has no prognostic value in breast cancer; high levels of EZH2 are associated with poor outcome to tamoxifen therapy in advanced breast cancer; downregulated EZH2 leads to upregulation of the ER and better response to anti-estrogens
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies enhancer of zeste homolog 2 (EZH2) is important for HIV-1 replication
20132185 high EZH2 expression is associated with tumor cell proliferation and metastasis in gastric cancer.
20127006 EZH2 and BMI-1 are upregulated in osteosarcoma. EZH2 and BMI-1 may be useful targets for cancer immunotherapy of osteosarcoma, although knock-down of EZH2 and BMI-1 could not prevent osteosarcoma growth.
20087897 There is a strong correlation between EZH2 overexpression and advanced stage, aggressive prostate cancers.
20081860 EZH2 proteins with mutant Tyr641 have reduced enzymatic activity in vitro.
20015867 Although EZH2 does not influence the basal level of apoptotic activity, its overexpression protects the tumor cells against the proapoptotic action of (-)-epigallocatechin-3-gallate.
19969553 Omega-3 PUFAs degrade EZH2 via posttranslational mechanisms. EZH2 downregulation by omega-3 PUFAs decreases histone 3 lysine 27 trimethylation activity of EZH2 & upregulation of E-cadherin & IGFBP3, which are known targets of EZH2.
19934320 Direct transcriptional regulation of c-myc by EZH2 may constitute a novel mechanism underlying GBM CSC maintenance.
19934278 Data show that EZH2 is a crucial regulator of GAGE2 expression.
19904743 findings suggest that high expression of EZH2 correlates with tumor aggressiveness and adverse patient outcome in ESCC treated with definitive chemoradiotherapy
19901851 Genetic polymorphisms in the EZH2 gene is associated with lung cancer.
19901851 Observational study of gene-disease association. (HuGE Navigator)
19893569 Data show that E2F1 induces EZH2 expression, which in turn antagonizes the induction of E2F1 pro-apoptotic target Bim expression.
19773751 increased EZH2 protein expression and Ki-67 expression in >40% of the tumour cells are both associated with an improved relapse-free survival in colon cancer stages II and III, but not so in rectal cancer.
19723877 EZH2-mediated neoplastic transformation of the normal prostate epithelial cell line benign prostate hyperplasia 1 (BPH1) was confirmed by in vivo tumor growth and in vitro colony formation.
19709408 An increase in EZH2 protein levels is evident in tumors from BRCA1-mutation carriers. BRCA1-deficient cells are dependent on EZH2, whereas BRCA1-proficient cells are not.
19578722 histone modification including PRC2-mediated repressive histone marker H3K27me3 and active histone marker acH4 may involve in CD11b transcription during HL-60 leukemia cells reprogramming to terminal differentiation[polycomb repressive complex 2 ]
19564843 EZH2 may be responsible for the escape from cellular senescence followed by malignant transformation in the gallbladder of pancreaticobiliary maljunction.
19386347 Distinct expression of EZH2 in hepatocellular carcinoma is reported.
19340297 study reveals a novel epigenetic mechanism governing CDKN1C repression in breast cancer. As a newly identified EZH2 target with prognostic value, it has implications in patient stratification for cancer therapeutic targeting EZH2-mediated gene repression
19289832 EZH2 regulated stemness genes such as nerve growth factor receptor (NGFR), as well as genes involved in neuroectodermal and endothelial differentiation (EMP1, EPHB2, GFAP, and GAP43).EZH2 might have a central role in Ewing tumors pathology
19279403 Panobinostat treatment depletes EZH2 levels and enhances decitabine mediated de-repression of JunB and loss of survival of human acute leukemia cells.
19258506 Results confirm that miR-101 directly represses EZH2 and stable EZH2 knockdowns in TCC cell lines create a similar growth suppressive phenotype.
19099573 EZH2 overexpression is associated with TP53 mutation in breast cancer.
19079346 EZH2 is important in ER-negative breast cancer growth in vivo and in vitro, and BRCA1 is required for the proliferative effects of EZH2
19074885 Observational study of gene-disease association. (HuGE Navigator)
19047178 E7 target gene EZH2 is a major determinant for the proliferation of HPV-positive cancer cells and contributes to their apoptotic resistance.
19026781 EZH2 maintains repressive chromatin through different mechanisms.
19008416 study proposes that the genomic loss of miR-101 in cancer leads to overexpression of EZH2 and concomitant dysregulation of epigenetic pathways, resulting in cancer progression
18980972 EZH2 nuclear overexpression contributes to pancreatic cancer cell proliferation.
18806826 Repression of E-cadherin by the polycomb group protein EZH2 in cancer is reported.
18713946 MYC stimulates EZH2 expression by repression of its negative regulator miR-26a
18637271 Expression changes in EZH2 are associated with DNA methylation in prostate cancer.
18628979 the two PRC2 components SUZ12 and EZH2 are sumoylated in vitro and in vivo
18623083 EZH2 gene plays a role for both the proliferation and the apoptosis resistance of renal cell carcinoma cells
18591938 overexpression associated with the malignant progression of hepatocellular carcinoma
18502945 A direct mediator of long-range intra- and interchromosomal interactions that can regulate transcriptional down-regulation of multiple genes by facilitating physical proximities between distant chromatin regions
18488029 EZH2 mediates histone H3 lysine 27 trimethylation as a mechanism of tumor-suppressor gene silencing in cancer that is potentially independent of promoter DNA methylation
18430739 RUNX3 is a target for repression by EZH2 in gastric cancer cells
18406871 Overexpression of EZH2 is associated with primary prostate carcinoma
18377425 This study provides into the mechanisms underlying the functional role of EZH2 overexpression in gastric cancer cells and a new modality of regulation of E-cadherin expression in silencing mechanisms of tumor suppressor genes.
18285464 PHF1 modulates the activity of Ezh2 in favor of the repressive H3K27me3 mark
18269588 EZH2 expression was associated with decreased survival of patients with basal-like phenotype of breast cancer.
18159594 Data show that EZH2 mRNA expression in circulating epithelial cells represents a promising marker for detecting early metastasis in prostate cancer.
18095286 EZH2 may regulate actin polymerization dynamics and thereby promote prostate cancer cell motility and invasiveness.
17996646 ADRB2 inhibition confers cell invasion and transforms benign prostate epithelial cells, whereas ADRB2 overexpression counteracts EZH2-mediated oncogenesis
17911618 EZH2 is involved in transcriptional down-regulation of interferon gamma-induced MHC class II transactivator (CIITA) expression in uveal melanoma.
17804093 NIPP1 is present in a complex with EED and EZH2 in vivo and has distinct binding sites for these proteins.
17694325 EZH2 expression levels were correlated to pathological tumor features and outcome in patients with urothelial carcinoma of the bladder.
17676662 The comprehensive downstream pathways of EZH2 were determined by proteomic profiling.
17640228 EZH2 protein levels increase incrementally from benign nevi to melanoma, which suggests that EZH2 may play a role in the pathogenesis and progression of melanoma
17596871 EZH2 plays a key role in hepatocellular carcinoma tumorigenesis, and is a novel therapeutic target.
17545586 Expressed target cancer genes with minimal DNA methylation have increased transcription during EZH2 knockdown, densely DNA hypermethylated and silenced genes retain their methylation and remain transcriptionally silent.
17541304 APAF-1 methylation is related to transcriptional activity of EZH2 expression in early-stage tumor disease of the bladder.
17502350 These experiments indicated that EZH2 is a dual function transcription regulator with a dynamic activity, and we provide a mechanism for EZH2 in tumorigenesis.
17453341 EZH2 regulates the transcription of estrogen-responsive genes through association with REA, an estrogen receptor corepressor
17344414 Study shows that the ability of the oncogene BMI1 to repress the INK4A-ARF locus requires its direct association and is dependent on the continued presence of the EZH2-containing Polycomb-Repressive Complex 2 complex.
17332078 Ezh2 has a role in aging of the hematopoietic stem cell system [review]
17237810 Our data disclose a hitherto unexplored link between the putative oncogene EZH2 and the tumor suppressor PSP94, and show that MSMB is silenced by EZH2 in advanced prostate cancer cells.
17134822 PcG protein EZH2 is associated with adverse pathological features and clinical PSA recurrence of prostate cancer.
17018586 Review. EZH2 is up-regulated in ductal carcinoma in situ, atypical ductal hyperplasia, and even morphologically normal breast epithelial cells from women who have an increased risk of breast cancer. EZH2 may promote neoplastic conversion.
16963837 Advanced cell- & animal imaging, expression profiling, stable siRNA-gene targeting, and TMAs of experimental and clinical samples indicate that activation of the Ezh2 oncogene-associated PcG pathway plays an essential role in metastatic prostate cancer.
16855786 We summarize the current knowledge on the function of EZH2 in cancer, with special focus on breast cancer, and propose a link between EZH2, the homologous recombination pathway of DNA repair, and breast tumorigenesis.
16717091 EZH2 is important for the maintenance of circadian rhythms and has a role in the core clockwork mechanism of mammals
16575874 A fraction of late-stage tumors contains the gene amplification leading to the overexpression of the EZH2 gene, thus indicating the importance of EZH2 in the progression of prostate cancer
16489070 Findings indicate an important relationship not only between EZH2 and markers of tumor cell proliferation but also with aggressive disease.
16361539 Increased EZH2 expression correlates with oncogenesis of the bladder.
16357870 EZH2 is required for DNA methylation of EZH2-target promoters; results suggest that EZH2 serves as a recruitment platform for DNA methyltransferases
16331887 A link between EZH2, a regulator of homeotic gene expression, and recombination DNA repair.
16314526 EZH2 is essential for BMI1 recruitment to the polycomb bodies.
16224021 results imply that Akt regulates the methylation activity, through phosphorylation of EZH2, which may contribute to oncogenesis
16215315 Deregulated expression of EZH2 is associated with bladder carcinoma.
16015586 Observational study of gene-disease association. (HuGE Navigator)
15882624 Results show the existence of the cytosolic Ezh2-containing methyltransferase complex and tie the function of this complex to regulation of actin polymerization in various cell types.
15856046 The findings of this study indicate that EZH2 mRNA expression was upregulated in human HCC and may play an important role in tumour progression, especially by facilitating portal vein invasion.
15817459 hDAB2IP gene is a target gene of Ezh2 in prostatic epithelium, which provides an underlying mechanism of the down-regulation of hDAB2IP gene in prostate cancer
15208672 Activated p53 suppresses EZH2 expression, suggesting a further role for p53 in epigenetic regulation and in the maintenance of genetic stability.
15099518 Different EZH2-containing complexes target methylation of histones or nucleosomal histones
15077161 Ezh2 competes with HDAC1 in binding to pRb2/p130, disrupting their occupancy on the cyclin A promoter.
14965441 deregulated expression of EZH2 is associated with loss of differentiation and development of poorly differentiated breast cancer in humans
14532106 essential for the proliferation of both transformed and non-transformed human cells
14500907 functional role of EZH2 in cancer cell invasion and breast cancer progression
12374981 is overexpressed in hormone-refractory, metastatic prostate cancer; may be involved in the progression of prostate cancer, as well as being a marker that distinguishes indolent prostate cancer from those at risk of lethal progression

AA Sequence

MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI      1 - 70
LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD     71 - 140
QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK    141 - 210
ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS    211 - 280
FHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRP    281 - 350
GGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM    351 - 420
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPR    421 - 490
KKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGC    491 - 560
RCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKD    561 - 630
PVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVM    631 - 700
MVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP                            701 - 746
//

Text Mined References (584)

PMID Year Title
27113214 2016 EZH2 overexpression in different immunophenotypes of breast carcinoma and association with clinicopathologic features.
26970171 2016 Down-regulation of EZH2 expression in myelodysplastic syndromes.
26964089 2016 Uropathogenic E. coli (UPEC) Infection Induces Proliferation through Enhancer of Zeste Homologue 2 (EZH2).
26897964 2015 EZH2 Mediates the Regulation of S100A4 on E-cadherin Expression and the Proliferation, Migration of Gastric Cancer Cells.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26871869 2016 The JMJD3 Histone Demethylase and the EZH2 Histone Methyltransferase in Prostate Cancer.
26781064 2016 A double-negative feedback loop between EZH2 and miR-26a regulates tumor cell growth in hepatocellular carcinoma.
26766588 2016 Polycomb Repressive Complex 2 Is a Barrier to KRAS-Driven Inflammation and Epithelial-Mesenchymal Transition in Non-Small-Cell Lung Cancer.
26735435 2015 Epigenetic regulation of autophagy by the methyltransferase EZH2 through an MTOR-dependent pathway.
26733151 2016 MicroRNA-26a suppresses epithelial-mesenchymal transition in human hepatocellular carcinoma by repressing enhancer of zeste homolog 2.
26718325 2016 Reciprocal negative feedback loop between EZH2 and miR-101-1 contributes to miR-101 deregulation in hepatocellular carcinoma.
26683709 2016 Prognostic value of high EZH2 expression in patients with different types of cancer: a systematic review with meta-analysis.
26659825 2016 Integrative Analysis Reveals the Transcriptional Collaboration between EZH2 and E2F1 in the Regulation of Cancer-Related Gene Expression.
26655220 2016 Wilms Tumor Suppressor, WT1, Cooperates with MicroRNA-26a and MicroRNA-101 to Suppress Translation of the Polycomb Protein, EZH2, in Mesenchymal Stem Cells.
26648239 2016 A crucial epithelial to mesenchymal transition regulator, Sox4/Ezh2 axis is closely related to the clinical outcome in pancreatic cancer patients.
26632198 2015 EZH2 phosphorylation regulates Tat-induced HIV-1 transactivation via ROS/Akt signaling pathway.
26593398 2015 EZH2 is highly expressed in pituitary adenomas and associated with proliferation.
26590165 2016 EZH2 Inhibition Blocks Multiple Myeloma Cell Growth through Upregulation of Epithelial Tumor Suppressor Genes.
26587974 2015 Mutant p53 induces EZH2 expression and promotes epithelial-mesenchymal transition by disrupting p68-Drosha complex assembly and attenuating miR-26a processing.
26573802 2015 miR-124 and Androgen Receptor Signaling Inhibitors Repress Prostate Cancer Growth by Downregulating Androgen Receptor Splice Variants, EZH2, and Src.
26553291 2015 Molecular and pathological characterization of the EZH2 rs3757441 single nucleotide polymorphism in colorectal cancer.
26552012 2016 Chromatin remodeling gene EZH2 involved in the genetic etiology of autism in Chinese Han population.
26552009 2015 SWI/SNF-mutant cancers depend on catalytic and non-catalytic activity of EZH2.
26517694 2015 Phosphorylation-mediated EZH2 inactivation promotes drug resistance in multiple myeloma.
26517683 2015 A Polycomb-mir200 loop regulates clinical outcome in bladder cancer.
26517640 2015 Cancer stem cell markers in prostate cancer: an immunohistochemical study of ALDH1, SOX2 and EZH2.
26517514 2015 Mutual regulation between CHD5 and EZH2 in hepatocellular carcinoma.
26516927 2015 LncRNA MALAT1 enhances oncogenic activities of EZH2 in castration-resistant prostate cancer.
26499080 2015 Ezh2 is involved in radial neuronal migration through regulating Reelin expression in cerebral cortex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26484567 2015 Honokiol inhibits bladder tumor growth by suppressing EZH2/miR-143 axis.
26457648 2015 Juvenile myelomonocytic leukemia displays mutations in components of the RAS pathway and the PRC2 network.
26452129 2015 MicroRNA-506 suppresses tumor proliferation and metastasis in colon cancer by directly targeting the oncogene EZH2.
26435191 2016 Functional roles of enhancer of zeste homolog 2 in gliomas.
26431491 2015 Long non-coding RNA profiling links subgroup classification of endometrioid endometrial carcinomas with trithorax and polycomb complex aberrations.
26424790 2015 Epigenetic Control of Skeletal Development by the Histone Methyltransferase Ezh2.
26416763 2016 The decrease in histone methyltransferase EZH2 in response to fluid shear stress alters endothelial gene expression and promotes quiescence.
26415832 2015 Posttranscriptional silencing of the lncRNA MALAT1 by miR-217 inhibits the epithelial-mesenchymal transition via enhancer of zeste homolog 2 in the malignant transformation of HBE cells induced by cigarette smoke extract.
26404566 2015 EZH2-mediated loss of miR-622 determines CXCR4 activation in hepatocellular carcinoma.
26392259 2015 Overexpression of enhancer of zeste homolog 2 (EZH2) characterizes an aggressive subset of prostate cancers and predicts patient prognosis independently from pre- and postoperatively assessed clinicopathological parameters.
26378045 2015 NBAT1 suppresses breast cancer metastasis by regulating DKK1 via PRC2.
26378043 2015 Targeting EZH2 regulates tumor growth and apoptosis through modulating mitochondria dependent cell-death pathway in HNSCC.
26377323 2015 EZH2 is a sensitive marker of malignancy in salivary gland tumors.
26370511 2015 Global Transcriptome Analysis Reveals That Poly(ADP-Ribose) Polymerase 1 Regulates Gene Expression through EZH2.
26362062 2015 Activation of SAPK/JNK mediated the inhibition and reciprocal interaction of DNA methyltransferase 1 and EZH2 by ursolic acid in human lung cancer cells.
26360609 2015 Acquisition of a single EZH2 D1 domain mutation confers acquired resistance to EZH2-targeted inhibitors.
26317265 2015 Epigenetic reprogramming in solid tumors: therapeutic implications of EZH2 gain-of-function mutations.
26305882 2015 Methyltransferase expression and tumor suppressor gene methylation in sporadic and familial colorectal cancer.
26304929 2015 Targeting activating mutations of EZH2 leads to potent cell growth inhibition in human melanoma by derepression of tumor suppressor genes.
26280220 2015 Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma.
26271144 2015 Clinical and prognostic relevance of EZH2 in breast cancer: A meta-analysis.
26268246 2015 Activation of EZH2 and SUZ12 Regulated by E2F1 Predicts the Disease Progression and Aggressive Characteristics of Bladder Cancer.
26265454 2015 Enhancer of zeste homolog 2 silencing inhibits tumor growth and lung metastasis in osteosarcoma.
26191190 2015 MicroRNA-1297 regulates hepatocellular carcinoma cell proliferation and apoptosis by targeting EZH2.
26162541 2015 The possible role of EZH2 and DNMT1 polymorphisms in sporadic triple-negative breast carcinoma in southern Chinese females.
26111449 2015 A new kinetochore component CENP-W interacts with the polycomb-group protein EZH2 to promote gene silencing.
26104761 2015 SIRT1 affects DNA methylation of polycomb group protein target genes, a hotspot of the epigenetic shift observed in ageing.
26096306 2015 EZH2 expression in gliomas: Correlation with CDKN2A gene deletion/ p16 loss and MIB-1 proliferation index.
26032517 2015 hMOF (human males absent on the first), an oncogenic protein of human oral tongue squamous cell carcinoma, targeting EZH2 (enhancer of zeste homolog 2).
26004298 2015 Enhancer of zeste homolog 2 depletion induces cellular senescence via histone demethylation along the INK4/ARF locus.
26002960 2015 Mediator complex cooperatively regulates transcription of retinoic acid target genes with Polycomb Repressive Complex 2 during neuronal differentiation.
25979827 2015 Reciprocal regulation of amino acid import and epigenetic state through Lat1 and EZH2.
25969142 2015 Survival of skin cancer stem cells requires the Ezh2 polycomb group protein.
25955318 2015 Involvement of enhancer of zeste homolog 2 in cisplatin-resistance in ovarian cancer cells by interacting with several genes.
25955299 2015 Tetraspanin Family Member, CD82, Regulates Expression of EZH2 via Inactivation of p38 MAPK Signaling in Leukemia Cells.
25947258 2015 Genome-wide transcriptional profiling analysis reveals annexin A6 as a novel EZH2 target gene involving gastric cellular proliferation.
25938557 2015 Confluence-Induced Squamous Differentiation Is Not Accompanied by Changes in H3K27me3 Repressive Epigenetic Mark.
25917318 2015 Enhancer of zeste homolog-2 (EZH2) methyltransferase regulates transgelin/smooth muscle-22? expression in endothelial cells in response to interleukin-1? and transforming growth factor-?2.
25907866 2015 MicroRNA-144 suppresses tumorigenesis and tumor progression of astrocytoma by targeting EZH2.
25890085 2015 Antitumor effects of pharmacological EZH2 inhibition on malignant peripheral nerve sheath tumor through the miR-30a and KPNB1 pathway.
25877750 2015 Overexpression of YB1 and EZH2 are associated with cancer metastasis and poor prognosis in renal cell carcinomas.
25869101 2015 microRNA-217 inhibits tumor progression and metastasis by downregulating EZH2 and predicts favorable prognosis in gastric cancer.
25833838 2015 TR4 Nuclear Receptor Alters the Prostate Cancer CD133+ Stem/Progenitor Cell Invasion via Modulating the EZH2-Related Metastasis Gene Expression.
25824776 2015 siRNA silencing EZH2 reverses cisplatin-resistance of human non-small cell lung and gastric cancer cells.
25800736 2015 PCAF-primed EZH2 acetylation regulates its stability and promotes lung adenocarcinoma progression.
25767098 2015 STAT3-driven transcription depends upon the dimethylation of K49 by EZH2.
25762643 2015 Snail and Slug collaborate on EMT and tumor metastasis through miR-101-mediated EZH2 axis in oral tongue squamous cell carcinoma.
25746006 2015 DNA methylation in small cell lung cancer defines distinct disease subtypes and correlates with high expression of EZH2.
25739318 2015 The polycomb group protein enhancer of zeste 2 is a novel therapeutic target for cervical cancer.
25695204 2015 Regulation of the expression of claudin 23 by the enhancer of zeste 2 polycomb group protein in colorectal cancer.
25671303 2015 Epigenetic reprogramming by tumor-derived EZH2 gain-of-function mutations promotes aggressive 3D cell morphologies and enhances melanoma tumor growth.
25657202 2015 Immunohistochemical validation of overexpressed genes identified by global expression microarrays in adrenocortical carcinoma reveals potential predictive and prognostic biomarkers.
25651430 2015 Strong expression of EZH2 and accumulation of trimethylated H3K27 in diffuse large B-cell lymphoma independent of cell of origin and EZH2 codon 641 mutation.
25648270 2015 Ezh2 mediated H3K27me3 activity facilitates somatic transition during human pluripotent reprogramming.
25644061 2015 SOX4 interacts with EZH2 and HDAC3 to suppress microRNA-31 in invasive esophageal cancer cells.
25633838 2015 EZH2 promotes tumor progression via regulating VEGF-A/AKT signaling in non-small cell lung cancer.
25614949 2015 Epigenetic modifications in cutaneous malignant melanoma: EZH2, H3K4me2, and H3K27me3 immunohistochemical expression is enhanced at the invasion front of the tumor.
25614281 2015 Gestational diabetes mellitus impairs fetal endothelial cell functions through a mechanism involving microRNA-101 and histone methyltransferase enhancer of zester homolog-2.
25609585 2015 The epigenetic modifier EZH2 controls melanoma growth and metastasis through silencing of distinct tumour suppressors.
25601206 2015 EZH2 protects glioma stem cells from radiation-induced cell death in a MELK/FOXM1-dependent manner.
25600645 2015 Long Noncoding RNA MALAT1 Promotes Aggressive Renal Cell Carcinoma through Ezh2 and Interacts with miR-205.
25595591 2015 DNMT1 and EZH2 mediated methylation silences the microRNA-200b/a/429 gene and promotes tumor progression.
25586788 2015 EZH2 expression is a prognostic factor in childhood intracranial ependymoma: a Canadian Pediatric Brain Tumor Consortium study.
25578878 2015 Developmental control of polycomb subunit composition by GATA factors mediates a switch to non-canonical functions.
25571919 2015 Alterations in enhancer of zeste homolog 2, matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-2 expression are associated with ex vivo and in vitro bone metastasis in renal cell carcinoma.
25550361 2015 Acute myeloid leukemia ontogeny is defined by distinct somatic mutations.
25549357 2014 EZH2 regulates cofilin activity and colon cancer cell migration by targeting ITGA2 gene.
25537508 2015 RUNX1, an androgen- and EZH2-regulated gene, has differential roles in AR-dependent and -independent prostate cancer.
25501205 2014  Effect of siRNA targeting EZH2 on cell viability and apoptosis of bladder cancer T24 cells.
25500144 2015 A CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patients.
25499219 2014 The transcriptional repressor ZBTB4 regulates EZH2 through a MicroRNA-ZBTB4-specificity protein signaling axis.
25494962 2015 miR-26a promoted by interferon-alpha inhibits hepatocellular carcinoma proliferation and migration by blocking EZH2.
25486432 2015 Role of bacterial infection in the epigenetic regulation of Wnt antagonist WIF1 by PRC2 protein EZH2.
25472588 2014 MiR-32 functions as a tumor suppressor and directly targets EZH2 in human oral squamous cell carcinoma.
25444902 2015 EZH2 is a negative prognostic factor and exhibits pro-oncogenic activity in glioblastoma.
25431952 2014 H2AK119Ub1 and H3K27Me3 in molecular staging for survival prediction of patients with pancreatic ductal adenocarcinoma.
25431950 2014 Pharmacologic down-regulation of EZH2 suppresses bladder cancer in vitro and in vivo.
25428914 2015 Long non-coding RNA HOTAIR promotes glioblastoma cell cycle progression in an EZH2 dependent manner.
25428391 2015 Interleukin-1?-mediated suppression of microRNA-101 and upregulation of enhancer of zeste homolog 2 is involved in particle-induced lung cancer.
25417162 2014 ATRX directs binding of PRC2 to Xist RNA and Polycomb targets.
25416956 2014 A proteome-scale map of the human interactome network.
25400745 2014 Inhibition of EZH2 reverses chemotherapeutic drug TMZ chemosensitivity in glioblastoma.
25400732 2014 miR-101 suppresses tumor proliferation and migration, and induces apoptosis by targeting EZH2 in esophageal cancer cells.
25355039 2015 Prognostic value of COX-2, P53, and EZH-2 evaluated by quantitative image analysis in premalignant and malignant breast lesions.
25350786 2015 Anxiety is associated with higher levels of global DNA methylation and altered expression of epigenetic and interleukin-6 genes.
25341040 2014 Polycomb protein EZH2 suppresses apoptosis by silencing the proapoptotic miR-31.
25326896 2015 Expression and clinicopathological significance of EED, SUZ12 and EZH2 mRNA in colorectal cancer.
25294424 2014 Overexpression of enhancer of zeste human homolog 2 (EZH2) gene in human cytomegalovirus positive glioblastoma multiforme tissues.
25289642 2015 Cellular senescence in biliary pathology. Special emphasis on expression of a polycomb group protein EZH2 and a senescent marker p16INK4a in bile ductular tumors and lesions.
25280519 2014 EZH2 elevates the proliferation of human cholangiocarcinoma cells through the downregulation of RUNX3.
25275664 2014 Analyzing simultaneous positive expression of EZH2 and P53 protein to improve predictive value in cervical squamous cell carcinoma.
25275047 2014 Activating mutations affecting the NF-kappa B pathway and EZH2-mediated epigenetic regulation are rare events in primary mediastinal large B-cell lymphoma.
25266721 2014 c-Rel regulates Ezh2 expression in activated lymphocytes and malignant lymphoid cells.
25263318 2015 Enhancer of zeste homolog 2 is widely expressed in T-cell neoplasms, is associated with high proliferation rate and correlates with MYC and pSTAT3 expression in a subset of cases.
25262426 2014 Expression of the enhancer of zeste homolog 2 in biopsy specimen predicts chemoresistance and survival in advanced non-small cell lung cancer receiving first-line platinum-based chemotherapy.
25260883 2014 miR-101 regulates expression of EZH2 and contributes to progression of and cisplatin resistance in epithelial ovarian cancer.
25253781 2014 A687V EZH2 is a driver of histone H3 lysine 27 (H3K27) hypertrimethylation.
25252918 2014 In vivo disruption of an Rb-E2F-Ezh2 signaling loop causes bladder cancer.
25243792 2014 Prognostic value of polycomb proteins EZH2, BMI1 and SUZ12 and histone modification H3K27me3 in colorectal cancer.
25237831 2014 EZH2 promotes angiogenesis through inhibition of miR-1/Endothelin-1 axis in nasopharyngeal carcinoma.
25226601 2014 Aberrant upregulation of 14-3-3? and EZH2 expression serves as an inferior prognostic biomarker for hepatocellular carcinoma.
25225797 2014 The KDM2B- let-7b -EZH2 axis in myelodysplastic syndromes as a target for combined epigenetic therapy.
25193989 2014 High protein expression of EZH2 is related to unfavorable outcome to tamoxifen in metastatic breast cancer.
25190211 2014 MicroRNA-101 inhibits the metastasis of osteosarcoma cells by downregulation of EZH2 expression.
25189741 2015 EZH2 modulates angiogenesis in vitro and in a mouse model of limb ischemia.
25159232 2014 The prognostic role of EZH2 expression in rectal cancer patients treated with neoadjuvant chemoradiotherapy.
25154026 2014 Reaction coupling between wild-type and disease-associated mutant EZH2.
25131810 2015 Overexpression of EZH2 associates with a poor prognosis in chronic lymphocytic leukemia.
25115397 2014 EZH2 dependent H3K27me3 is involved in epigenetic silencing of ID4 in prostate cancer.
25088689 2014 Histone methyltransferase EZH2 is transcriptionally induced by estradiol as well as estrogenic endocrine disruptors bisphenol-A and diethylstilbestrol.
25085702 2014 Cardiac hypertrophy and dysfunction induced by overexpression of miR-214 in vivo.
25084021 2014 EZH2 is associated with malignant behavior in pancreatic IPMN via p27Kip1 downregulation.
25077680 2015 EZH2-induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in ovarian cancer.
25064842 2014 New tumor suppressor CXXC finger protein 4 inactivates mitogen activated protein kinase signaling.
25055869 2014 Polycomb group complexes are recruited to reactivated FMR1 alleles in Fragile X syndrome in response to FMR1 transcription.
25051981 2014 EZH2 expression correlates with locoregional recurrence after radiation in inflammatory breast cancer.
25047840 2014 Polycomb repressive complex 2 and H3K27me3 cooperate with H3K9 methylation to maintain heterochromatin protein 1? at chromatin.
25046371 2014 Epigenetic modification in gliomas: role of the histone methyltransferase EZH2.
25043748 2015 The methyltransferase EZH2 is not required for mammary cancer development, although high EZH2 and low H3K27me3 correlate with poor prognosis of ER-positive breast cancers.
25036033 2014 Role of EZH2 polymorphisms in esophageal squamous cell carcinoma risk in Han Chinese population.
25032847 2014 Integrative epigenome analysis identifies a Polycomb-targeted differentiation program as a tumor-suppressor event epigenetically inactivated in colorectal cancer.
25025074 2014 Number of polyploid giant cancer cells and expression of EZH2 are associated with VM formation and tumor grade in human ovarian tumor.
25017995 2014 Autoregulatory feedback loop of EZH2/miR-200c/E2F3 as a driving force for prostate cancer development.
25017254 2014 Aberrant expression of enhancer of zeste homologue 2, correlated with HIF-1?, refines relapse risk and predicts poor outcome for breast cancer.
25007342 2014 Long noncoding RNA-EBIC promotes tumor cell invasion by binding to EZH2 and repressing E-cadherin in cervical cancer.
25005166 2015 Inhibition of EZH2 expression is associated with the proliferation, apoptosis, and migration of SW620 colorectal cancer cells in vitro.
24986100 2015 EZH2 promotes tumor progression by increasing VEGF expression in clear cell renal cell carcinoma.
24967960 2014 EZH2-mediated epigenetic suppression of long noncoding RNA SPRY4-IT1 promotes NSCLC cell proliferation and metastasis by affecting the epithelial-mesenchymal transition.
24953053 2014 Ezh2 loss promotes development of myelodysplastic syndrome but attenuates its predisposition to leukaemic transformation.
24928441 2014 The polycomb group protein EZH2 inhibits lung cancer cell growth by repressing the transcription factor Nrf2.
24916103 2014 EZH2 represses target genes through H3K27-dependent and H3K27-independent mechanisms in hepatocellular carcinoma.
24878960 2014 MicroRNA miR-124 controls the choice between neuronal and astrocyte differentiation by fine-tuning Ezh2 expression.
24857928 2014 Manipulating the epigenome in germinal center lymphomas: is it getting easier and ezier?
24850841 2014 VEGF/VEGFR-2 upregulates EZH2 expression in lung adenocarcinoma cells and EZH2 depletion enhances the response to platinum-based and VEGFR-2-targeted therapy.
24845612 2014 The functional and mechanistic relatedness of EZH2 and menin in hepatocellular carcinoma.
24813658 2014 Epigenetic-related gene expression profile in medullary thyroid cancer revealed the overexpression of the histone methyltransferases EZH2 and SMYD3 in aggressive tumours.
24807198 2014 MiR-101, downregulated in retinoblastoma, functions as a tumor suppressor in human retinoblastoma cells by targeting EZH2.
24804542 2014 TET1 exerts its tumor suppressor function by interacting with p53-EZH2 pathway in gastric cancer.
24798718 2014 A polymorphism in the promoter is associated with EZH2 expression but not with outcome in advanced pancreatic cancer patients.
24771265 2014 EZH2-specific microRNA-98 inhibits human ovarian cancer stem cell proliferation via regulating the pRb-E2F pathway.
24745014 2014 EZH2 silencing with RNA interference induces G2/M arrest in human lung cancer cells in vitro.
24739462 2014 IKK? restoration via EZH2 suppression induces nasopharyngeal carcinoma differentiation.
24738879 2014 Inhibition enhancer of zeste homologue 2 promotes senescence and apoptosis induced by doxorubicin in p53 mutant gastric cancer cells.
24705718 2014 Role of EZH2 protein expression in gastric carcinogenesis among Asians: a meta-analysis.
24691023 2014 Impact of EZH2 polymorphisms on urothelial cell carcinoma susceptibility and clinicopathologic features.
24671995 2014 Coordinated regulation of dendrite arborization by epigenetic factors CDYL and EZH2.
24658854 2014 MicroRNA-124 inhibits proliferation and induces apoptosis by directly repressing EZH2 in gastric cancer.
24652950 2014 A central role for G9a and EZH2 in the epigenetic silencing of cyclooxygenase-2 in idiopathic pulmonary fibrosis.
24634383 2014 EZH2 mutations in follicular lymphoma from different ethnic groups and associated gene expression alterations.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
24612432 2016 Enhancer of zeste homolog 2 (EZH2) promotes tumour cell migration and invasion via epigenetic repression of E-cadherin in renal cell carcinoma.
24612037 2014 Inhibition of histone methyltransferase EZH2 depletes leukemia stem cell of mixed lineage leukemia fusion leukemia through upregulation of p16.
24608043 2014 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, ?-catenin and EZH2.
24588771 2014 Inhibiting enhancer of zeste homolog 2 promotes cellular senescence in gastric cancer cells SGC-7901 by activation of p21 and p16.
24516139 2014 EZH2 expands breast stem cells through activation of NOTCH1 signaling.
24501407 2014 Short-chain fatty acids from periodontal pathogens suppress histone deacetylases, EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24499724 2014 Overexpression of MYC and EZH2 cooperates to epigenetically silence MST1 expression.
24488618 2014 Association between EZH2 polymorphisms and colorectal cancer risk in Han Chinese population.
24487593 2014 Immunostaining for polycomb group protein EZH2 and senescent marker p16INK4a may be useful to differentiate cholangiolocellular carcinoma from ductular reaction and bile duct adenoma.
24474760 2014 O-GlcNAcylation regulates EZH2 protein stability and function.
24469045 2015 PRC2-independent chromatin compaction and transcriptional repression in cancer.
24469040 2015 Oncogenic Y641 mutations in EZH2 prevent Jak2/?-TrCP-mediated degradation.
24446035 2014 Clinicopathological and prognostic significance of EZH2 expression in upper urinary tract carcinoma.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
24424512 2014 Role of EZH2 in oral squamous cell carcinoma carcinogenesis.
24413452 Increased expression of enhancer of Zeste Homolog 2 (EZH2) differentiates squamous cell carcinoma from normal skin and actinic keratosis.
24406044 2013 MiR-138 induces renal carcinoma cell senescence by targeting EZH2 and is downregulated in human clear cell renal cell carcinoma.
24403021 2015 LncRNAs: new players in gliomas, with special emphasis on the interaction of lncRNAs With EZH2.
24389103 2014 The histone H3 lysine 9 methyltransferases G9a and GLP regulate polycomb repressive complex 2-mediated gene silencing.
24367637 2013 Structural context of disease-associated mutations and putative mechanism of autoinhibition revealed by X-ray crystallographic analysis of the EZH2-SET domain.
24367611 2013 Structure of the catalytic domain of EZH2 reveals conformational plasticity in cofactor and substrate binding sites and explains oncogenic mutations.
24351808 2013 EZH2 down-regulation exacerbates lipid accumulation and inflammation in in vitro and in vivo NAFLD.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
24346863 2014 Statins inhibit tumor progression via an enhancer of zeste homolog 2-mediated epigenetic alteration in colorectal cancer.
24344012 Prognostic value of EZH2, paxillin expression and DNA ploidy of breast adenocarcinoma: correlation to pathologic predictors.
24339737 2013 The oncogenic polycomb histone methyltransferase EZH2 methylates lysine 120 on histone H2B and competes ubiquitination.
24335192 2014 EZH2 participates in malignant biological behavior of epithelial ovarian cancer through regulating the expression of BRCA1.
24320048 2013 Binding interactions between long noncoding RNA HOTAIR and PRC2 proteins.
24312307 2013 Prognostic value of EZH2 expression and activity in renal cell carcinoma: a prospective study.
24292603 2014 The histone methyltransferase EZH2, an oncogene common to benign and malignant parathyroid tumors.
24289559 2013 Triptolide inhibits histone methyltransferase EZH2 and modulates the expression of its target genes in prostate cancer cells.
24266940 2013 EZH2 expression in invasive lobular carcinoma of the breast.
24218139 2013 Concurrent loss of Ezh2 and Tet2 cooperates in the pathogenesis of myelodysplastic disorders.
24214728 2013 Weaver syndrome and EZH2 mutations: Clarifying the clinical phenotype.
24213577 2014 The Polycomb group (PcG) protein EZH2 supports the survival of PAX3-FOXO1 alveolar rhabdomyosarcoma by repressing FBXO32 (Atrogin1/MAFbx).
24212330 2014 Cancer-associated fibroblasts enhance the migration ability of ovarian cancer cells by increasing EZH2 expression.
24211739 2014 MicroRNA-101 inhibits human hepatocellular carcinoma progression through EZH2 downregulation and increased cytostatic drug sensitivity.
24139839 2013 Combined aberrant expression of Bmi1 and EZH2 is predictive of poor prognosis in glioma patients.
24132643 2014 EZH2-miR-30d-KPNB1 pathway regulates malignant peripheral nerve sheath tumour cell survival and tumourigenesis.
24132606 2013 EZH2 regulates cancer cell migration through repressing TIMP-3 in non-small cell lung cancer.
24123378 2014 EZH2 and KDM6A act as an epigenetic switch to regulate mesenchymal stem cell lineage specification.
24122997 2013 Aberrant expression of EZH2 is associated with pathological findings and P53 alteration.
24107828 2013 A key role for EZH2 in epigenetic silencing of HOX genes in mantle cell lymphoma.
24097870 2013 EZH2 protein expression associates with the early pathogenesis, tumor progression, and prognosis of non-small cell lung carcinoma.
24097338 2014 EZH2 in normal and malignant hematopoiesis.
24079759 2013 Enhancer of zeste homolog 2 expression is associated with metastasis and adverse clinical outcome in clear cell renal cell carcinoma: a comparative study and review of the literature.
24079712 2013 Genomic pathway analysis reveals that EZH2 and HDAC4 represent mutually exclusive epigenetic pathways across human cancers.
24077223 2013 Promiscuous RNA binding by Polycomb repressive complex 2.
24074865 2013 Dnmt3L antagonizes DNA methylation at bivalent promoters and favors DNA methylation at gene bodies in ESCs.
24074410 2013 EZH2-shRNA-mediated upregulation of p21waf1/cip1 and its transcriptional enhancers with concomitant downmodulation of mutant p53 in pancreatic ductal adenocarcinoma.
24055345 2013 PAF and EZH2 induce Wnt/?-catenin signaling hyperactivation.
24052547 2013 EZH2 mutations are frequent and represent an early event in follicular lymphoma.
24040354 2013 Effects of EZH2 polymorphisms on susceptibility to and pathological development of hepatocellular carcinoma.
24032713 2013 Histone trimethylation of the p53 gene by expression of a constitutively active prolactin receptor in prostate cancer cells.
24018208 2013 The role of Sp1 and EZH2 in the regulation of LMX1A in cervical cancer cells.
23967231 2013 Genomic deregulation of the E2F/Rb pathway leads to activation of the oncogene EZH2 in small cell lung cancer.
23962556 2013 MiR-101 inhibits melanoma cell invasion and proliferation by targeting MITF and EZH2.
23949225 2013 Enhancer of zeste homolog 2 activates wnt signaling through downregulating CXXC finger protein 4.
23948956 2013 In aggressive variants of non-Hodgkin lymphomas, Ezh2 is strongly expressed and polycomb repressive complex PRC1.4 dominates over PRC1.2.
23918806 2013 Expression of polycomb targets predicts breast cancer prognosis.
23907130 2013 Polycomb repressive complex 2 contributes to DNA double-strand break repair.
23893242 2014 Scaffold attachment factor B1 regulates the androgen receptor in concert with the growth inhibitory kinase MST1 and the methyltransferase EZH2.
23887863 2013 Enhancer of zeste homolog 2 (EZH2) promotes progression of cholangiocarcinoma cells by regulating cell cycle and apoptosis.
23874688 2013 Inhibition of GSK 3? activity is associated with excessive EZH2 expression and enhanced tumour invasion in nasopharyngeal carcinoma.
23857401 2013 EZH2 promotes E2F-driven SCLC tumorigenesis through modulation of apoptosis and cell-cycle regulation.
23815091 2013 miR-144 downregulation increases bladder cancer cell proliferation by targeting EZH2 and regulating Wnt signaling.
23803132 2013 Absence of EZH2 gene mutation in chronic myeloid leukemia patients in blast crisis.
23792601 2013 Inhibition of enhancer of zeste homolog 2 (EZH2) expression is associated with decreased tumor cell proliferation, migration, and invasion in endometrial cancer cell lines.
23759596 2013 EZH2 and ALDH1 expression in ductal carcinoma in situ: complex association with recurrence and progression to invasive breast cancer.
23759589 2013 Three-dimensional culture sensitizes epithelial ovarian cancer cells to EZH2 methyltransferase inhibition.
23739676 2013 Role of EZH2 in the growth of prostate cancer stem cells isolated from LNCaP cells.
23707559 2013 Suppression of tumorigenicity by microRNA-138 through inhibition of EZH2-CDK4/6-pRb-E2F1 signal loop in glioblastoma multiforme.
23684459 2013 Phosphorylation of EZH2 activates STAT3 signaling via STAT3 methylation and promotes tumorigenicity of glioblastoma stem-like cells.
23677067 2013 FEZF2, a novel 3p14 tumor suppressor gene, represses oncogene EZH2 and MDM2 expression and is frequently methylated in nasopharyngeal carcinoma.
23636867 2014 EZH2, a unique marker of malignancy in effusion cytology.
23636686 2013 EZH2, an epigenetic driver of prostate cancer.
23624935 2013 BRCA1 is a negative modulator of the PRC2 complex.
23613835 2013 EZH2 mutations are related to low blast percentage in bone marrow and -7/del(7q) in de novo acute myeloid leukemia.
23603558 2013 EZH2 blockade by RNA interference inhibits growth of ovarian cancer by facilitating re-expression of p21(waf1/cip1) and by inhibiting mutant p53.
23592277 2013 The NSD1 and EZH2 overgrowth genes, similarities and differences.
23562851 2013 Silencing the EZH2 gene by RNA interference reverses the drug resistance of human hepatic multidrug-resistant cancer cells to 5-Fu.
23557329 2013 Identification of microRNA-mRNA functional interactions in UVB-induced senescence of human diploid fibroblasts.
23539298 2013 EZH2 inhibition decreases p38 signaling and suppresses breast cancer motility and metastasis.
23538750 2013 Disruption of the MYC-miRNA-EZH2 loop to suppress aggressive B-cell lymphoma survival and clonogenicity.
23529930 2013 EZH2 overexpression in natural killer/T-cell lymphoma confers growth advantage independently of histone methyltransferase activity.
23526793 2013 Smurf2-mediated degradation of EZH2 enhances neuron differentiation and improves functional recovery after ischaemic stroke.
23523787 2013 The role of EZH2 and DNA methylation in hMLH1 silencing in epithelial ovarian cancer.
23486531 2013 Multiple mechanisms deregulate EZH2 and histone H3 lysine 27 epigenetic changes in myeloid malignancies.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23438432 2013 Downregulated LncRNA-ANCR promotes osteoblast differentiation by targeting EZH2 and regulating Runx2 expression.
23421437 2013 Sorafenib suppresses growth and survival of hepatoma cells by accelerating degradation of enhancer of zeste homolog 2.
23395645 2013 Enhancer of zeste homolog 2 silences microRNA-218 in human pancreatic ductal adenocarcinoma cells by inducing formation of heterochromatin.
23361872 2013 EZH2 and CD79B mutational status over time in B-cell non-Hodgkin lymphomas detected by high-throughput sequencing using minimal samples.
23354591 2013 Long non-coding RNA H19 increases bladder cancer metastasis by associating with EZH2 and inhibiting E-cadherin expression.
23343715 2013 MiR-138 inhibits tumor growth through repression of EZH2 in non-small cell lung cancer.
23300840 2012 EZH2 promotes malignant behaviors via cell cycle dysregulation and its mRNA level associates with prognosis of patient with non-small cell lung cancer.
23294722 2013 [Expressions of EZH2 and RUNX3 in renal cell carcinoma and their clinical significance].
23291714 2013 RNAi-mediated EZH2 depletion decreases MDR1 expression and sensitizes multidrug-resistant hepatocellular carcinoma cells to chemotherapy.
23289480 2013 EZH2 regulates the expression of p16 in the nasopharyngeal cancer cells.
23283488 2013 EZH2 is required for breast and pancreatic cancer stem cell maintenance and can be used as a functional cancer stem cell reporter.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23239736 2012 EZH2 oncogenic activity in castration-resistant prostate cancer cells is Polycomb-independent.
23228130 2013 PRAME/EZH2-mediated regulation of TRAIL: a new target for cancer therapy.
23190500 2013 Inhibition of EZH2 suppresses self-renewal and induces radiation sensitivity in atypical rhabdoid teratoid tumor cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163606 2013 Overexpression of enhancer of zeste homolog 2 and MUC1 may be related to malignant behaviour in intraductal papillary neoplasm of the bile duct.
23159737 2013 Characterization of the EZH2-MMSET histone methyltransferase regulatory axis in cancer.
23135913 2013 MYC acts via the PTEN tumor suppressor to elicit autoregulation and genome-wide gene repression by activation of the Ezh2 methyltransferase.
23121604 2012 Expression of EZH2 in renal cell carcinoma as a novel prognostic marker.
23116973 2013 EZH2 is regulated by ERK/AKT and targets integrin alpha2 gene to control Epithelial-Mesenchymal Transition and anoikis in colon cancer cells.
23104054 2012 Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.
23099237 2013 TET2, ASXL1 and EZH2 mutations in Chinese with myelodysplastic syndromes.
23095338 2013 Significance of cyclooxygenase 2, EZH-2 polycomb group and p53 expression in actinic keratosis and squamous cell carcinomas of the skin.
23079660 2012 Coordinated silencing of MYC-mediated miR-29 by HDAC3 and EZH2 as a therapeutic target of histone modification in aggressive B-Cell lymphomas.
23077658 2012 Promotion of glioblastoma cell motility by enhancer of zeste homolog 2 (EZH2) is mediated by AXL receptor kinase.
23063525 2012 EZH2 generates a methyl degron that is recognized by the DCAF1/DDB1/CUL4 E3 ubiquitin ligase complex.
23001607 2013 Non-coding RNAs and EZH2 interactions in cancer: long and short tales from the transcriptome.
22994729 2012 Prognostic significance of overexpression of EZH2 and H3k27me3 proteins in gastric cancer.
22992977 2012 Downregulation of Ezh2 expression by RNA interference induces cell cycle arrest in the G0/G1 phase and apoptosis in U87 human glioma cells.
22986524 2013 EZH2 promotes a bi-lineage identity in basal-like breast cancer cells.
22972404 2012 Let-7a inhibits proliferation and induces apoptosis by targeting EZH2 in nasopharyngeal carcinoma cells.
22956625 2012 Enhancer of zeste homolog 2 is overexpressed and contributes to epigenetic inactivation of p21 and phosphatase and tensin homolog in B-cell acute lymphoblastic leukemia.
22948084 2012 Genetic and epigenetic loss of microRNA-31 leads to feed-forward expression of EZH2 in melanoma.
22930729 2012 Genome-wide DNA methylation events in TMPRSS2-ERG fusion-negative prostate cancers implicate an EZH2-dependent mechanism with miR-26a hypermethylation.
22914328 2012 Notch1 intracellular domain increases cytoplasmic EZH2 levels during early megakaryopoiesis.
22897849 2012 ASXL1 mutations promote myeloid transformation through loss of PRC2-mediated gene repression.
22871469 2013 Overexpression of enhancer of zeste homolog 2 (EZH2) and focal adhesion kinase (FAK) in high grade endometrial carcinoma.
22869879 2012 Validation of a prognostic model and the impact of mutations in patients with lower-risk myelodysplastic syndromes.
22867052 2012 MicroRNA-98 and microRNA-214 post-transcriptionally regulate enhancer of zeste homolog 2 and inhibit migration and invasion in human esophageal squamous cell carcinoma.
22855181 2013 Quantitative analysis of EZH2 expression and its correlations with lung cancer patients' clinical pathological characteristics.
22850114 2012 A687V EZH2 is a gain-of-function mutation found in lymphoma patients.
22809481 2012 Enhancer of zeste homologue 2 (EZH2) is a reliable immunohistochemical marker to differentiate malignant and benign hepatic tumors.
22800347 2012 [Effects of enhancer of zeste homolog (EZH2) downregulation on the proliferation and invasion of nasopharyngeal carcinoma cell and the possible mechanisms].
22766604 2012 Co-expression of Bmi1 and EZH2 as an independent poor prognostic factor in esophageal squamous cell carcinoma.
22766277 2012 Global H3K27 trimethylation and EZH2 abundance in breast tumor subtypes.
22705924 2012 DNA methylation analyses of urothelial carcinoma reveal distinct epigenetic subtypes and an association between gene copy number and methylation status.
22696229 2012 EZH2-regulated DAB2IP is a medulloblastoma tumor suppressor and a positive marker for survival.
22677129 2012 Ezh2 augments leukemogenicity by reinforcing differentiation blockage in acute myeloid leukemia.
22675170 2012 TP53 genomic status regulates sensitivity of gastric cancer cells to the histone methylation inhibitor 3-deazaneplanocin A (DZNep).
22659877 2012 Intronic RNAs mediate EZH2 regulation of epigenetic targets.
22609199 2012 The enhancer of zeste homolog 2 (EZH2), a potential therapeutic target, is regulated by miR-101 in renal cancer cells.
22593192 2012 Cancer angiogenesis induced by Kaposi sarcoma-associated herpesvirus is mediated by EZH2.
22588437 The effect of prostate tissue inflammation in benign prostatic hyperplasia on enhancer of zeste homolog 2 ribonucleic acid expression.
22563434 2012 Dysregulated recruitment of the histone methyltransferase EZH2 to the class II transactivator (CIITA) promoter IV in breast cancer cells.
22552406 2012 The expression and significance of the enhancer of zeste homolog 2 in lung adenocarcinoma.
22544210 2012 Prognostic impact of the cancer stem cell related markers ALDH1 and EZH2 in triple negative and basal-like breast cancers.
22527102 2012 Invasive breast carcinomas in Ghana: high frequency of high grade, basal-like histology and high EZH2 expression.
22505648 2012 Polycomb protein EZH2 regulates tumor invasion via the transcriptional repression of the metastasis suppressor RKIP in breast and prostate cancer.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22469510 2012 MicroRNA-26a regulates tumorigenic properties of EZH2 in human lung carcinoma cells.
22465358 2012 Mallory-Denk bodies form when EZH2/H3K27me3 fails to methylate DNA in the nuclei of human and mice liver cells.
22450781 2012 Lack of microRNA-101 causes E-cadherin functional deregulation through EZH2 up-regulation in intestinal gastric cancer.
22442719 2012 Loss of let-7 up-regulates EZH2 in prostate cancer consistent with the acquisition of cancer stem cell signatures that are attenuated by BR-DIM.
22439931 2012 Deconstruction of the SS18-SSX fusion oncoprotein complex: insights into disease etiology and therapeutics.
22436627 2012 Clinical and biological relevance of enhancer of zeste homolog 2 in triple-negative breast cancer.
22431509 2012 A key role for EZH2 and associated genes in mouse and human adult T-cell acute leukemia.
22383679 2012 EZH2 polymorphism and benefit from bevacizumab in colorectal cancer: another piece to the puzzle.
22370893 2012 Enhancer of zeste homolog 2 epigenetically silences multiple tumor suppressor microRNAs to promote liver cancer metastasis.
22349693 2012 Inner workings and regulatory inputs that control Polycomb repressive complex 2.
22323599 2012 Mutation of A677 in histone methyltransferase EZH2 in human B-cell lymphoma promotes hypertrimethylation of histone H3 on lysine 27 (H3K27).
22308284 2012 Genetic defects in PRC2 components other than EZH2 are not common in myeloid malignancies.
22287205 2012 Targeting the enhancer of zeste homologue 2 in medulloblastoma.
22272343 2012 The role of EZH2 in the regulation of the activity of matrix metalloproteinases in prostate cancer cells.
22266912 2012 A somatic EZH2 mutation in childhood acute myeloid leukemia.
22237151 2012 Genetic inactivation of the polycomb repressive complex 2 in T cell acute lymphoblastic leukemia.
22235851 2012 EZH2 mutations and their association with PICALM-MLLT10 positive acute leukaemia.
22228224 2014 EZH2 genetic variants affect risk of gastric cancer in the Chinese Han population.
22222375 2012 RAS oncogenic signal upregulates EZH2 in pancreatic cancer.
22211105 2012 EZH2 methyltransferase and H3K27 methylation in breast cancer.
22194861 2011 EZH2 codon 641 mutations are common in BCL2-rearranged germinal center B cell lymphomas.
22190405 2011 Germline mutations in the oncogene EZH2 cause Weaver syndrome and increased human height.
22187039 2012 The role of EZH2 in tumour progression.
22177091 2012 Mutations in EZH2 cause Weaver syndrome.
22161744 2013 Polycomb group protein EZH2-mediated E-cadherin repression promotes metastasis of oral tongue squamous cell carcinoma.
22094255 2011 Oxidative damage targets complexes containing DNA methyltransferases, SIRT1, and polycomb members to promoter CpG Islands.
22068036 2012 EZH2 Mediates epigenetic silencing of neuroblastoma suppressor genes CASZ1, CLU, RUNX3, and NGFR.
22009739 2011 Corepressor protein CDYL functions as a molecular bridge between polycomb repressor complex 2 and repressive chromatin mark trimethylated histone lysine 27.
21989926 2012 Up-regulation of enhancer of zeste homolog 2 is associated positively with cyclin D1 overexpression and poor clinical outcome in head and neck squamous cell carcinoma.
21941025 2011 Myc enforces overexpression of EZH2 in early prostatic neoplasia via transcriptional and post-transcriptional mechanisms.
21932133 2012 Carcinogenesis of intraductal papillary mucinous neoplasm of the pancreas: loss of microRNA-101 promotes overexpression of histone methyltransferase EZH2.
21926398 2012 An EZH2 polymorphism is associated with clinical outcome in metastatic colorectal cancer patients.
21921784 2011 Malignant rhabdoid tumors express stem cell factors, which relate to the expression of EZH2 and Id proteins.
21921040 2011 EZH2 mutational status predicts poor survival in myelofibrosis.
21914347 2011 [Expression and relationship of Ezh2, Runx3 and caspase-3 in endometrial adenocarcinoma].
21903722 2011 Down-regulation of the histone methyltransferase EZH2 contributes to the epigenetic programming of decidualizing human endometrial stromal cells.
21892211 2012 Silencing of Kruppel-like factor 2 by the histone methyltransferase EZH2 in human cancer.
21884980 2011 Context-specific regulation of NF-?B target gene expression by EZH2 in breast cancers.
21865393 2011 Evidence for alteration of EZH2, BMI1, and KDM6A and epigenetic reprogramming in human papillomavirus type 16 E6/E7-expressing keratinocytes.
21856302 2011 The Y641C mutation of EZH2 alters substrate specificity for histone H3 lysine 27 methylation states.
21837672 2012 Enhancer of zeste homolog 2 is a novel prognostic biomarker in nonsmall cell lung cancer.
21828135 2011 Mutational spectrum analysis of chronic myelomonocytic leukemia includes genes associated with epigenetic regulation: UTX, EZH2, and DNMT3A.
21769904 2011 Long noncoding RNA high expression in hepatocellular carcinoma facilitates tumor growth through enhancer of zeste homolog 2 in humans.
21765901 2011 EZH2 depletion blocks the proliferation of colon cancer cells.
21761357 2010 In utero exposure to diethylstilbestrol (DES) or bisphenol-A (BPA) increases EZH2 expression in the mammary gland: an epigenetic mechanism linking endocrine disruptors to breast cancer.
21719208 2011 Overexpression of EZH2 and loss of expression of PTEN is associated with invasion, metastasis, and poor progression of gallbladder adenocarcinoma.
21715480 2011 Epigenetic silencing of HIV-1 by the histone H3 lysine 27 methyltransferase enhancer of Zeste 2.
21713757 2011 Polycomb group protein EZH2 is frequently expressed in inflammatory breast cancer and is predictive of worse clinical outcome.
21703114 2011 Inhibition of SIRT1 increases EZH2 protein level and enhances the repression of EZH2 on target gene expression.
21697275 2011 EZH2 promotes malignant phenotypes and is a predictor of oral cancer development in patients with oral leukoplakia.
21690062 2011 [Expressions of p53 pathway genes and EZH2 in undifferentiated nasopharyngeal carcinoma].
21685935 2012 EZH2 supports nasopharyngeal carcinoma cell aggressiveness by forming a co-repressor complex with HDAC1/HDAC2 and Snail to inhibit E-cadherin.
21659531 2011 Cyclin-dependent kinase 1 (CDK1)-mediated phosphorylation of enhancer of zeste 2 (Ezh2) regulates its stability.
21629038 2011 Enhancer of zeste homolog 2 expression is associated with tumor cell proliferation and invasion in cervical cancer.
21614903 2011 The value of TOP2A, EZH2 and paxillin expression as markers of aggressive breast cancer: relationship with other prognostic factors.
21614565 2012 Increased risk for distant metastasis in patients with familial early-stage breast cancer and high EZH2 expression.
21609503 2011 Enhancer of zeste homolog 2 (EZH2) in pediatric soft tissue sarcomas: first implications.
21572997 2011 DNA methyltransferase controls stem cell aging by regulating BMI1 and EZH2 through microRNAs.
21546904 2011 Polycomb protein EZH2 regulates cancer cell fate decision in response to DNA damage.
21539681 2011 Validation of the histone methyltransferase EZH2 as a therapeutic target for various types of human cancer and as a prognostic marker.
21532618 2011 The tumor suppressor gene rap1GAP is silenced by miR-101-mediated EZH2 overexpression in invasive squamous cell carcinoma.
21515604 2011 Expression and function of EZH2 in synovial fibroblasts: epigenetic repression of the Wnt inhibitor SFRP1 in rheumatoid arthritis.
21512140 2011 EZH2-mediated concordant repression of Wnt antagonists promotes ?-catenin-dependent hepatocarcinogenesis.
21499305 2011 MEK-ERK pathway regulates EZH2 overexpression in association with aggressive breast cancer subtypes.
21455215 2011 Concomitant analysis of EZH2 and ASXL1 mutations in myelofibrosis, chronic myelomonocytic leukemia and blast-phase myeloproliferative neoplasms.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21406404 2011 Histone methyltransferase EZH2 induces Akt-dependent genomic instability and BRCA1 inhibition in breast cancer.
21399658 2011 p53-paralog DNp73 oncogene is repressed by IFN?/STAT2 through the recruitment of the Ezh2 polycomb group transcriptional repressor.
21399615 2011 EZH2 and ALDH-1 mark breast epithelium at risk for breast cancer development.
21396836 Increased EZH2 protein expression is associated with invasive urothelial carcinoma of the bladder.
21383005 2011 EZH2-dependent suppression of a cellular senescence phenotype in melanoma cells by inhibition of p21/CDKN1A expression.
21368858 2010 Enhancer of Zeste homolog 2 (EZH2) is overexpressed in recurrent nasopharyngeal carcinoma and is regulated by miR-26a, miR-101, and miR-98.
21367748 2011 Aberrations of EZH2 in cancer.
21339759 2011 Molecular profiling of chronic myelomonocytic leukemia reveals diverse mutations in >80% of patients with TET2 and EZH2 being of high prognostic relevance.
21339190 2011 DNA hypermethylation profiles associated with glioma subtypes and EZH2 and IGFBP2 mRNA expression.
21325804 2011 Enhancer of zeste homologue 2 expression in breast carcinoma smears in relationship with p53, Ki-67 and other prognostic parameters.
21321380 2010 miR-101 is down-regulated in glioblastoma resulting in EZH2-induced proliferation, migration, and angiogenesis.
21307773 2011 Genetics of the myeloproliferative neoplasms.
21297974 2011 Down-regulation of miR-101 in endothelial cells promotes blood vessel formation through reduced repression of EZH2.
21292308 2011 High-grade neuroendocrine carcinomas of the lung highly express enhancer of zeste homolog 2, but carcinoids do not.
21289264 2011 Enhancer of zeste homolog 2 overexpression has a role in the development of anaplastic thyroid carcinomas.
21233829 2011 EZH2 Y641 mutations in follicular lymphoma.
21232178 2010 Epigenetic repression of SATB1 by polycomb group protein EZH2 in epithelial cells.
21228036 2011 Overexpression of Enhancer of zeste homolog 2 with trimethylation of lysine 27 on histone H3 in adult T-cell leukemia/lymphoma as a target for epigenetic therapy.
21216957 2011 EZH2 regulates neuronal differentiation of mesenchymal stem cells through PIP5K1C-dependent calcium signaling.
21215703 2011 EZH2 promotes expansion of breast tumor initiating cells through activation of RAF1-?-catenin signaling.
21205084 2011 EZH2 regulates expression of p57 and contributes to progression of ovarian cancer in vitro and in vivo.
21199804 2011 MiR-26a inhibits cell growth and tumorigenesis of nasopharyngeal carcinoma through repression of EZH2.
21190999 2011 Somatic mutations at EZH2 Y641 act dominantly through a mechanism of selectively altered PRC2 catalytic activity, to increase H3K27 trimethylation.
21165554 2011 Aberrant expression of EZH2 is associated with a poor outcome and P53 alteration in squamous cell carcinoma of the esophagus.
21131960 2011 CDK1-dependent phosphorylation of EZH2 suppresses methylation of H3K27 and promotes osteogenic differentiation of human mesenchymal stem cells.
21125401 2011 Overexpression of the EZH2, RING1 and BMI1 genes is common in myelodysplastic syndromes: relation to adverse epigenetic alteration and poor prognostic scoring.
21116854 2011 Comparison of gene expression profiles reveals aberrant expression of FOXO1, Aurora A/B and EZH2 in lesional psoriatic skins.
21115743 2010 Enhancer of zeste homolog 2 promotes the proliferation and invasion of epithelial ovarian cancer cells.
21087793 2011 Absence of mutations of the histone methyltransferase gene EZH2 in splenic b-cell marginal zone lymphoma.
21078963 2010 Coordinated activities of wild-type plus mutant EZH2 drive tumor-associated hypertrimethylation of lysine 27 on histone H3 (H3K27) in human B-cell lymphomas.
20952513 2011 Pathologically decreased miR-26a antagonizes apoptosis and facilitates carcinogenesis by targeting MTDH and EZH2 in breast cancer.
20946108 2011 Enhancer of Zeste 2 (EZH2) is up-regulated in malignant gliomas and in glioma stem-like cells.
20935635 2010 Cyclin-dependent kinases regulate epigenetic gene silencing through phosphorylation of EZH2.
20920340 2010 Enhancer of zeste homolog 2 (EZH2) expression is an independent prognostic factor in renal cell carcinoma.
20864510 2010 ANCCA/ATAD2 overexpression identifies breast cancer patients with poor prognosis, acting to drive proliferation and survival of triple-negative cells through control of B-Myb and EZH2.
20863566 2011 Mutational analysis of EZH2 codon 641 in non-Hodgkin lymphomas and leukemias.
20858097 2010 Somatic mutations altering Tyr641 of EZH2 are rare in primary central nervous system lymphoma.
20736451 2010 EZH2-mediated epigenetic silencing in germinal center B cells contributes to proliferation and lymphomagenesis.
20724984 2010 Novel homo- and hemizygous mutations in EZH2 in myeloid malignancies.
20686362 2010 Overexpression of EZH2 contributes to acquired cisplatin resistance in ovarian cancer cells in vitro and in vivo.
20684863 2010 RNAi targeting EZH2 inhibits tumor growth and liver metastasis of pancreatic cancer in vivo.
20616235 2010 Long noncoding RNA as modular scaffold of histone modification complexes.
20601954 2010 Somatic mutations of the histone methyltransferase gene EZH2 in myelodysplastic syndromes.
20601953 2010 Inactivating mutations of the histone methyltransferase gene EZH2 in myeloid disorders.
20573371 2010 Implications of enhancer of zeste homologue 2 expression in pancreatic ductal adenocarcinoma.
20569692 2010 ESCs require PRC2 to direct the successful reprogramming of differentiated cells toward pluripotency.
20564407 2010 Distinctive expression of the polycomb group proteins Bmi1 polycomb ring finger oncogene and enhancer of zeste homolog 2 in nonsmall cell lung cancers and their clinical and clinicopathologic significance.
20480530 2010 EZH2 and STAT6 expression profiles are correlated with colorectal cancer stage and prognosis.
20479932 2010 ETS transcription factors control transcription of EZH2 and epigenetic silencing of the tumor suppressor gene Nkx3.1 in prostate cancer.
20478527 2010 An integrated network of androgen receptor, polycomb, and TMPRSS2-ERG gene fusions in prostate cancer progression.
20478051 2010 MicroRNA-101 negatively regulates Ezh2 and its expression is modulated by androgen receptor and HIF-1alpha/HIF-1beta.
20402834 2010 Expression of polycomb protein EZH2 in multi-stage tissues of gastric carcinogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20369694 2010 [EZH2 expression in human prostate cancer and its clinicopathologic significance].
20306127 2011 Decreased expression of EZH2 is associated with upregulation of ER and favorable outcome to tamoxifen in advanced breast cancer.
20154697 2010 An oncogene-tumor suppressor cascade drives metastatic prostate cancer by coordinately activating Ras and nuclear factor-kappaB.
20132185 2010 Enhancer of zeste homolog 2 expression is associated with tumor cell proliferation and metastasis in gastric cancer.
20127006 2010 The knock-down of overexpressed EZH2 and BMI-1 does not prevent osteosarcoma growth.
20087897 2010 Comprehensive evaluation of the role of EZH2 in the growth, invasion, and aggression of a panel of prostate cancer cell lines.
20081860 2010 Somatic mutations altering EZH2 (Tyr641) in follicular and diffuse large B-cell lymphomas of germinal-center origin.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20015867 2010 The Bmi-1 polycomb protein antagonizes the (-)-epigallocatechin-3-gallate-dependent suppression of skin cancer cell survival.
19969553 2010 Dietary omega-3 polyunsaturated fatty acids suppress expression of EZH2 in breast cancer cells.
19934320 2009 EZH2 is essential for glioblastoma cancer stem cell maintenance.
19934278 2009 Combinatorial pharmacologic approaches target EZH2-mediated gene repression in breast cancer cells.
19904743 2010 High expression of EZH2 is associated with tumor aggressiveness and poor prognosis in patients with esophageal squamous cell carcinoma treated with definitive chemoradiotherapy.
19901851 2010 Genetic polymorphisms in the polycomb group gene EZH2 and the risk of lung cancer.
19893569 2010 Polycomb protein EZH2 regulates E2F1-dependent apoptosis through epigenetically modulating Bim expression.
19773751 2009 Expression of EZH2 and Ki-67 in colorectal cancer and associations with treatment response and prognosis.
19734898 2009 The histone variant macroH2A is an epigenetic regulator of key developmental genes.
19723877 2009 Polycomb group protein enhancer of zeste 2 is an oncogene that promotes the neoplastic transformation of a benign prostatic epithelial cell line.
19709408 2009 BRCA1-deficient mammary tumor cells are dependent on EZH2 expression and sensitive to Polycomb Repressive Complex 2-inhibitor 3-deazaneplanocin A.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19578722 2009 Regulation of CD11b transcription by decreasing PRC2 and increased acH4 level during ATRA-induced HL-60 differentiation.
19564843 2009 Papillary hyperplasia of the gallbladder in pancreaticobiliary maljunction represents a senescence-related lesion induced by lysolecithin.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386347 2009 Distinct expression of polycomb group proteins EZH2 and BMI1 in hepatocellular carcinoma.
19340297 2009 CDKN1C (p57) is a direct target of EZH2 and suppressed by multiple epigenetic mechanisms in breast cancer cells.
19289832 2009 EZH2 is a mediator of EWS/FLI1 driven tumor growth and metastasis blocking endothelial and neuro-ectodermal differentiation.
19279403 2009 Panobinostat treatment depletes EZH2 and DNMT1 levels and enhances decitabine mediated de-repression of JunB and loss of survival of human acute leukemia cells.
19258506 2009 The putative tumor suppressor microRNA-101 modulates the cancer epigenome by repressing the polycomb group protein EZH2.
19144645 2009 Dynamic Histone H1 Isotype 4 Methylation and Demethylation by Histone Lysine Methyltransferase G9a/KMT1C and the Jumonji Domain-containing JMJD2/KDM4 Proteins.
19099573 2008 EZH2 and BMI1 inversely correlate with prognosis and TP53 mutation in breast cancer.
19079346 2009 Downregulation of EZH2 decreases growth of estrogen receptor-negative invasive breast carcinoma and requires BRCA1.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19047178 2008 Activation of the enhancer of zeste homologue 2 gene by the human papillomavirus E7 oncoprotein.
19026781 2008 Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms.
19008416 2008 Genomic loss of microRNA-101 leads to overexpression of histone methyltransferase EZH2 in cancer.
18980972 2008 Regulation of pancreatic tumor cell proliferation and chemoresistance by the histone methyltransferase enhancer of zeste homologue 2.
18806826 2008 Repression of E-cadherin by the polycomb group protein EZH2 in cancer.
18713946 2008 MYC stimulates EZH2 expression by repression of its negative regulator miR-26a.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18637271 2007 Expression changes in EZH2, but not in BMI-1, SIRT1, DNMT1 or DNMT3B are associated with DNA methylation changes in prostate cancer.
18628979 2008 The polycomb repressive complex 2 is a potential target of SUMO modifications.
18623083 2008 The enhancer of zeste homolog 2 gene contributes to cell proliferation and apoptosis resistance in renal cell carcinoma cells.
18591938 2008 The overexpression of polycomb group proteins Bmi1 and EZH2 is associated with the progression and aggressive biological behavior of hepatocellular carcinoma.
18502945 2008 A novel 6C assay uncovers Polycomb-mediated higher order chromatin conformations.
18488029 2008 Gene silencing in cancer by histone H3 lysine 27 trimethylation independent of promoter DNA methylation.
18430739 2008 Enhancer of zeste homologue 2 (EZH2) down-regulates RUNX3 by increasing histone H3 methylation.
18406871 2008 Expression changes of CAV1 and EZH2, located on 7q31 approximately q36, are rarely related to genomic alterations in primary prostate carcinoma.
18377425 2008 Enhancer of zeste homolog 2 downregulates E-cadherin by mediating histone H3 methylation in gastric cancer cells.
18285464 2008 Ezh2 requires PHF1 to efficiently catalyze H3 lysine 27 trimethylation in vivo.
18269588 2008 Independent prognostic value of the basal-like phenotype of breast cancer and associations with EGFR and candidate stem cell marker BMI-1.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18159594 2007 Identification of enhancer of zeste homolog 2 expression in peripheral circulating tumor cells in metastatic prostate cancer patients: a preliminary study.
18095286 2008 The Polycomb Group protein EZH2 regulates actin polymerization in human prostate cancer cells.
18086877 2008 Role of hPHF1 in H3K27 methylation and Hox gene silencing.
17996646 2007 Integrative genomics analysis reveals silencing of beta-adrenergic signaling by polycomb in prostate cancer.
17911618 2007 A role for EZH2 in silencing of IFN-gamma inducible MHC2TA transcription in uveal melanoma.
17804093 The transcriptional repression by NIPP1 is mediated by Polycomb group proteins.
17694325 2008 Expression of the polycomb group protein EZH2 and its relation to outcome in patients with urothelial carcinoma of the bladder.
17676662 2007 Proteomic analysis of EZH2 downstream target proteins in hepatocellular carcinoma.
17640228 2007 Expression of polycomb group protein EZH2 in nevi and melanoma.
17596871 2007 Lentivirus-mediated RNA interference targeting enhancer of zeste homolog 2 inhibits hepatocellular carcinoma growth through down-regulation of stathmin.
17560333 2007 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia.
17545586 2007 DNA methylation and complete transcriptional silencing of cancer genes persist after depletion of EZH2.
17541304 2007 EZH2 polycomb transcriptional repressor expression correlates with methylation of the APAF-1 gene in superficial transitional cell carcinoma of the bladder.
17502350 2007 Integration of estrogen and Wnt signaling circuits by the polycomb group protein EZH2 in breast cancer cells.
17453341 2008 EZH2 regulates the transcription of estrogen-responsive genes through association with REA, an estrogen receptor corepressor.
17344414 2007 The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.
17332078 2007 Epigenetic control of hematopoietic stem cell aging the case of Ezh2.
17237810 2007 The gene encoding the prostatic tumor suppressor PSP94 is a target for repression by the Polycomb group protein EZH2.
17210787 2007 pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.
17200670 2007 Polycomb-mediated methylation on Lys27 of histone H3 pre-marks genes for de novo methylation in cancer.
17172412 2006 Histone deacetylase inhibitors deplete enhancer of zeste 2 and associated polycomb repressive complex 2 proteins in human acute leukemia cells.
17134822 2007 Polycomb-group oncogenes EZH2, BMI1, and RING1 are overexpressed in prostate cancer with adverse pathologic and clinical features.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17018586 2006 Enhancer of Zeste 2 as a marker of preneoplastic progression in the breast.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16963837 2006 Essential role for activation of the Polycomb group (PcG) protein chromatin silencing pathway in metastatic prostate cancer.
16936726 2006 Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells.
16855786 2006 The Polycomb group protein Enhancer of Zeste 2: its links to DNA repair and breast cancer.
16717091 2006 The polycomb group protein EZH2 is required for mammalian circadian clock function.
16618801 2006 Genome-wide mapping of Polycomb target genes unravels their roles in cell fate transitions.
16575874 2006 The gene for polycomb group protein enhancer of zeste homolog 2 (EZH2) is amplified in late-stage prostate cancer.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16489070 2006 Expression of enhancer of zeste homologue 2 is significantly associated with increased tumor cell proliferation and is a marker of aggressive breast cancer.
16431907 2006 Substrate preferences of the EZH2 histone methyltransferase complex.
16361539 2005 Increased expression of the polycomb group gene, EZH2, in transitional cell carcinoma of the bladder.
16357870 2006 The Polycomb group protein EZH2 directly controls DNA methylation.
16331887 2005 The Polycomb group protein EZH2 impairs DNA repair in breast epithelial cells.
16314526 2005 Association of BMI1 with polycomb bodies is dynamic and requires PRC2/EZH2 and the maintenance DNA methyltransferase DNMT1.
16224021 2005 Akt-mediated phosphorylation of EZH2 suppresses methylation of lysine 27 in histone H3.
16215315 2005 Increased expression of EZH2, a polycomb group protein, in bladder carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16179254 2005 The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16015586 2005 Mutation screen and association study of EZH2 as a susceptibility gene for aggressive prostate cancer.
15882624 2005 Polycomb group protein ezh2 controls actin polymerization and cell signaling.
15856046 2005 Clinicopathological significance of EZH2 mRNA expression in patients with hepatocellular carcinoma.
15817459 2005 Down-regulation of human DAB2IP gene expression mediated by polycomb Ezh2 complex and histone deacetylase in prostate cancer.
15684044 2005 Composition and histone substrates of polycomb repressive group complexes change during cellular differentiation.
15536069 2005 A novel repressive E2F6 complex containing the polycomb group protein, EPC1, that interacts with EZH2 in a proliferation-specific manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385962 2004 Suz12 is essential for mouse development and for EZH2 histone methyltransferase activity.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231737 2004 Silencing of human polycomb target genes is associated with methylation of histone H3 Lys 27.
15225548 2004 SUZ12 is required for both the histone methyltransferase activity and the silencing function of the EED-EZH2 complex.
15208672 2004 Activated p53 suppresses the histone methyltransferase EZH2 gene.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15099518 2004 Different EZH2-containing complexes target methylation of histone H1 or nucleosomal histone H3.
15077161 2004 Ezh2 reduces the ability of HDAC1-dependent pRb2/p130 transcriptional repression of cyclin A.
14965441 Poorly differentiated breast carcinoma is associated with increased expression of the human polycomb group EZH2 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532106 2003 EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.
14500907 2003 EZH2 is a marker of aggressive breast cancer and promotes neoplastic transformation of breast epithelial cells.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435631 2002 Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.
12374981 2002 The polycomb group protein EZH2 is involved in progression of prostate cancer.
12351676 2002 Role of histone H3 lysine 27 methylation in Polycomb-group silencing.
12101246 2002 Selective interactions between vertebrate polycomb homologs and the SUV39H1 histone lysine methyltransferase suggest that histone H3-K9 methylation contributes to chromosomal targeting of Polycomb group proteins.
11571280 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein.
11342607 2001 Distinct BMI-1 and EZH2 expression patterns in thymocytes and mature T cells suggest a role for Polycomb genes in human T cell differentiation.
11158321 2001 The polycomb group protein EED interacts with YY1, and both proteins induce neural tissue in Xenopus embryos.
10780782 2000 The human EZH2 gene: genomic organisation and revised mapping in 7q35 within the critical region for malignant myeloid disorders.
10581039 1999 Transcriptional repression mediated by the human polycomb-group protein EED involves histone deacetylation.
9742080 1998 Point mutations in the WD40 domain of Eed block its interaction with Ezh2.
9584199 1998 Characterization of interactions between the mammalian polycomb-group proteins Enx1/EZH2 and EED suggests the existence of different mammalian polycomb-group protein complexes.
9584197 1998 Interaction of mouse polycomb-group (Pc-G) proteins Enx1 and Enx2 with Eed: indication for separate Pc-G complexes.
9499421 1998 Specific interaction between the XNP/ATR-X gene product and the SET domain of the human EZH2 protein.
9214638 1997 Mammalian homologues of the Polycomb-group gene Enhancer of zeste mediate gene silencing in Drosophila heterochromatin and at S. cerevisiae telomeres.
8954776 1996 Cloning of a human homolog of the Drosophila enhancer of zeste gene (EZH2) that maps to chromosome 21q22.2.
8921387 1996 Characterization of EZH1, a human homolog of Drosophila Enhancer of zeste near BRCA1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8649418 1996 Interaction of Vav with ENX-1, a putative transcriptional regulator of homeobox gene expression.