Property Summary

Ligand Count 1
NCBI Gene PubMed Count 22
PubMed Score 14.81
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.2e-04
Breast cancer -2.600 3.7e-02
breast carcinoma -1.100 5.9e-05
ductal carcinoma in situ -1.400 1.5e-05
glioblastoma -1.200 1.7e-04
invasive ductal carcinoma -1.700 3.9e-04
malignant mesothelioma 1.400 1.7e-05
medulloblastoma, large-cell -1.100 3.4e-03
non primary Sjogren syndrome sicca -1.200 2.1e-02
non-small cell lung cancer -1.014 1.9e-21
osteosarcoma -1.881 5.9e-05
ovarian cancer -1.700 1.7e-12
pediatric high grade glioma -1.200 6.3e-06
psoriasis -1.200 1.9e-07

 OMIM Phenotype (1)

Gene RIF (9)

AA Sequence

MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQS      1 - 70
MKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVK     71 - 140
EEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLP    141 - 210
VTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGP    211 - 280
NAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAML    281 - 350
HNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP    351 - 420
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPS    421 - 490
QKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPG    491 - 560
CRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIK    561 - 630
ESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKV    631 - 700
VMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL                           701 - 747
//

Text Mined References (26)

PMID Year Title