Property Summary

NCBI Gene PubMed Count 49
PubMed Score 42.14
PubTator Score 44.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.088 7.1e-05
Amyotrophic lateral sclerosis 1.033 7.5e-06
atypical teratoid / rhabdoid tumor 2.100 7.5e-03
ependymoma 1.400 4.6e-03
group 3 medulloblastoma -1.600 4.6e-02
interstitial cystitis -1.700 2.5e-03
lung adenocarcinoma -1.300 5.3e-11
lung cancer -1.100 5.4e-03
lung carcinoma -1.400 9.2e-11
nasopharyngeal carcinoma -1.300 9.8e-09
non-small cell lung cancer -1.080 1.5e-05
pituitary cancer -1.600 3.8e-03

Gene RIF (32)

AA Sequence

MEDSQDLNEQSVKKTCTESDVSQSQNSRSMEMQDLASPHTLVGGGDTPGSSKLEKSNLSSTSVTTNGTGG      1 - 70
ENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSAHQYSP     71 - 140
QLYPSKPYPHILSTPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQ    141 - 210
TQSPLQSGCLSYSPGFSTPQPGQTPYSYQMPGSSFAPSSTIYANNSVSNSTNFSGSQQDYPSYTAFGQNQ    211 - 280
YAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSK    281 - 350
SRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFNLADTH    351 - 420
LFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAASSANLCLPTGVRGGVDWMRKLAFRYRRVKE    421 - 490
LYNTYKNNVGGLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTRSNCINVLVTTTQLIPALAKVL    491 - 560
LYSLGGAFPIENIYSATKIGKESCFERIMQRFGRKVVYVVIGDGVEEEQAAKKHNMPFWRISSHSDLLAL    561 - 630
HQALELEYL                                                                 631 - 639
//

Text Mined References (54)

PMID Year Title