Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.64
PubTator Score 10.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.079 2.8e-06
glioblastoma 1.200 1.6e-05
medulloblastoma, large-cell 1.200 2.7e-05
tuberculosis and treatment for 6 months -1.200 1.6e-04

Protein-protein Interaction (9)

Gene RIF (3)

PMID Text
24367676 Benzbromarone metabolites and derivatives function as EYA3 inhibitory anti-angiogenic agents.
22723308 These studies identify EYA3 as a novel mediator of chemoresistance in Ewing sarcoma and define the molecular mechanisms of both EYA3 overexpression and of EYA3-mediated chemoresistance
19351884 EYA2 and EYA3 displayed specificity for Tyr-142 of H2A.X

AA Sequence

MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQ      1 - 70
MYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPS     71 - 140
QHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQA    141 - 210
CYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRK    211 - 280
NMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEV    281 - 350
ADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYR    351 - 420
KVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPAL    421 - 490
AKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGD    491 - 560
LVSLHQALELDFL                                                             561 - 573
//

Text Mined References (23)

PMID Year Title
24367676 2013 Structure-activity relationships of benzbromarone metabolites and derivatives as EYA inhibitory anti-angiogenic agents.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22971774 2013 The Eyes Absent proteins in development and disease.
22723308 2012 EWS/FLI1 regulates EYA3 in Ewing sarcoma via modulation of miRNA-708, resulting in increased cell survival and chemoresistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19901965 2010 Inhibition of Eyes Absent Homolog 4 expression induces malignant peripheral nerve sheath tumor necrosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19351884 2009 Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14628042 2003 Eya protein phosphatase activity regulates Six1-Dach-Eya transcriptional effects in mammalian organogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215533 2002 Molecular interaction and synergistic activation of a promoter by Six, Eya, and Dach proteins mediated through CREB binding protein.
10490620 1999 Cooperation of six and eya in activation of their target genes through nuclear translocation of Eya.
9887327 1999 EYA4, a novel vertebrate gene related to Drosophila eyes absent.
9049631 1997 Cloning and characterization of two vertebrate homologs of the Drosophila eyes absent gene.
9020840 1997 A human homologue of the Drosophila eyes absent gene underlies branchio-oto-renal (BOR) syndrome and identifies a novel gene family.