Property Summary

NCBI Gene PubMed Count 36
PubMed Score 29.96
PubTator Score 24.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.500 2.2e-02
posterior fossa group A ependymoma 2.600 6.6e-15
group 3 medulloblastoma 3.500 1.7e-07
medulloblastoma, large-cell 3.800 3.4e-05
non-small cell lung cancer 1.573 4.0e-09
colon cancer -2.800 5.9e-05
breast carcinoma -1.200 1.6e-04
Breast cancer -1.900 3.7e-06
ulcerative colitis -1.200 1.3e-02
ovarian cancer 1.400 3.2e-02

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
488837 confirmatory 21 / 4971 / 327395 qHTS Assay for Inhibitors of the Phosphatase Activity of Eya2
488939 summary 0 / 0 / 0 qHTS Assay for Inhibitors of the Phosphatase Activity of Eya2: Summary
504895 confirmatory 5 / 38 / 137 Inhibitors of Eya2ED: Hit Confirmation in Primary Screen
540357 other 2 / 0 / 0 Inhibitors of Eya2ED: Hit Confirmation in Malachite Green Secondary Assay
720540 confirmatory 462 / 502 / 318 qHTS for Inhibitors of the Phosphatase Activity of Eya2: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (17)

PMID Text
25555392 SIX1 and EYA are often co-overexpressed in tumors, and the SIX1-EYA2 interaction has been shown to be critical for metastasis in a breast cancer model.
24810906 Decreased expression of EYA2 is associated with pancreatic adenocarcinomas.
24508260 MIR30A represses Eya2 expression by binding to the 3'-untranslated region of Eya2.The MIR30A/EYA2 axis regulates breast cancer cell proliferation and migration.
24196439 This interaction suggests that CDK6 regulates EYA2 activity, a mechanism that could be important in development and in cancer.
23435380 Given that SIX1 and EYA are overexpressed in many tumor types, our data indicate that targeting the SIX1-EYA complex may be a potent approach to inhibit tumor progression in multiple cancer types
22987659 Functional roles of candidate genes EYA2 (20q13) and hsa-miR-375 (2q35) were studied by siRNA-mediated knock-down and overexpression, respectively, in hrHPV-containing cell lines.
22607316 Studies indicate that the RNA and protein levels of Eya2 is upregulated in ovarian cancer.
21706047 Data implicate Eya2 as a necessary co-factor for many of the metastasis promoting functions of Six1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19950702 Expression of EYA2 in lung adenocarcinoma is augmented.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858093 Based on observation that the dachshund-binding site is located between the catalytic core & Sine Oculis binding sites within ED-Eya2, we propose that catalytic activity can be translated to SO binding through DAC, which acts as a transcriptional switch.
19414679 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19351884 EYA2 and EYA3 displayed specificity for Tyr-142 of H2A.X
15705892 EYA2 was found to function as transcriptional activator in ovarian cancer cells by Gal4 assay and to promote tumor growth in vivo in xenograft models.

AA Sequence

MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYG      1 - 70
QTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGT     71 - 140
TGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHN    141 - 210
VPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETII    211 - 280
IFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNF    281 - 350
SADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEAL    351 - 420
TDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQR    421 - 490
FGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL                          491 - 538
//

Text Mined References (36)

PMID Year Title
25555392 2015 The SIX1-EYA transcriptional complex as a therapeutic target in cancer.
24810906 2014 Epigenetic silencing of EYA2 in pancreatic adenocarcinomas promotes tumor growth.
24508260 2014 miR-30a suppresses breast cancer cell proliferation and migration by targeting Eya2.
24196439 2014 CDK6 binds and promotes the degradation of the EYA2 protein.
23435380 2013 Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
22987659 2013 Focal aberrations indicate EYA2 and hsa-miR-375 as oncogene and tumor suppressor in cervical carcinogenesis.
22607316 2013 Human HAD phosphatases: structure, mechanism, and roles in health and disease.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21706047 2012 Eya2 is required to mediate the pro-metastatic functions of Six1 via the induction of TGF-? signaling, epithelial-mesenchymal transition, and cancer stem cell properties.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19950702 2009 [Expression of EYA2 in non-small cell lang cancer].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858093 2010 Crystal structure of ED-Eya2: insight into dual roles as a protein tyrosine phosphatase and a transcription factor.
19497856 2009 Biochemical and functional characterization of six SIX1 Branchio-oto-renal syndrome mutations.
19414679 2009 Genome-wide analysis of survival in early-stage non-small-cell lung cancer.
19351884 2009 Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15705892 2005 Transcriptional coactivator Drosophila eyes absent homologue 2 is up-regulated in epithelial ovarian cancer and promotes tumor growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12500905 2002 Six and Eya expression during human somitogenesis and MyoD gene family activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039049 2002 A novel Eyes Absent 2 protein is expressed in the human eye.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10906137 2000 The alpha subunits of Gz and Gi interact with the eyes absent transcription cofactor Eya2, preventing its interaction with the six class of homeodomain-containing proteins.
9887327 1999 EYA4, a novel vertebrate gene related to Drosophila eyes absent.
9195991 1997 Eyes absent: a gene family found in several metazoan phyla.
9110174 1997 Large-scale concatenation cDNA sequencing.
9049631 1997 Cloning and characterization of two vertebrate homologs of the Drosophila eyes absent gene.
9020840 1997 A human homologue of the Drosophila eyes absent gene underlies branchio-oto-renal (BOR) syndrome and identifies a novel gene family.
8619474 1996 A "double adaptor" method for improved shotgun library construction.