Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.39
PubTator Score 7.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.056 2.5e-02
active ulcerative colitis -1.237 6.7e-03
astrocytic glioma 1.600 1.7e-02
Astrocytoma, Pilocytic -2.200 1.8e-04
atypical teratoid / rhabdoid tumor -2.000 4.8e-03
chronic rhinosinusitis -1.319 8.5e-03
cutaneous lupus erythematosus -1.700 7.3e-03
ependymoma 2.100 3.0e-02
glioblastoma -1.900 9.8e-05
group 4 medulloblastoma 2.300 2.6e-03
interstitial cystitis -1.600 1.6e-03
intraductal papillary-mucinous adenoma (... 1.800 2.9e-04
intraductal papillary-mucinous carcinoma... 2.100 7.3e-04
intraductal papillary-mucinous neoplasm ... 2.700 3.1e-04
invasive ductal carcinoma -1.071 9.2e-03
lung cancer -1.500 1.6e-03
lung carcinoma -3.600 1.1e-38
malignant mesothelioma 2.000 9.4e-07
nasopharyngeal carcinoma -1.700 6.5e-05
oligodendroglioma 1.400 4.1e-02
osteosarcoma 2.670 3.0e-03
pancreatic cancer 1.200 1.1e-05
pediatric high grade glioma -2.300 4.2e-04
periodontitis -1.500 8.6e-25
Pick disease 1.700 1.5e-04
pituitary cancer 1.100 1.3e-02
primitive neuroectodermal tumor -2.100 2.8e-02
psoriasis -2.300 3.2e-04
spina bifida -2.692 4.1e-02

Gene RIF (7)

AA Sequence

MTKVPPAFDFSFLNDEEARKILQVLERNEELQRAEKDRISKLQKTKRDIRWLQGVTGEWFEEIQRKKFCN      1 - 70
ETDVSQMLKQPLTYRLSKEMAKNDPIELPTSRSKNVTNQKKPTPFSSRMSFRSSFASLFSFRKSGKETSK     71 - 140
LPSLGQKGCDGHAGPPMPVRGAAVQAKIYNSPLENHLVDSTFVPKPAVMREESGMPPPWDASLLENEFFQ    141 - 210
VLDDLDSKLAQEQSASSVNTRTPLNYGSRTQFGHFYSSGNRHGNITERHKKHYNETSNMSIYDILRPGTP    211 - 280
REGFKTFSPRTSTIYDMYRTREPRVFKEDYVQKNTFGSTSLCFDSRQRSALPATGHFTARSLHFPATTQS    281 - 350
KSGFIPPRHQQSPKRTPLSSIIWNRSDSSRDRENQEEFLRAPSPMEIDPADKYVYPRGFQENKRYESYHS    351 - 420
QNVYQRVSLNAPMENAMSPDTFENSENMPFYHQSNTFTRSFFSNTFGRSGEQRRFGQGPFWGQEKGHSFW    421 - 490
SDFHRSRKSFSSSDRDFEMISMEANSVSAIHGHNVSSEHWESFSSGYGTDVSRGQEEPHPWQFDFQRSTL    491 - 560
DSMVVSHGNETQLTPHFGTPNVCSMTGSSYHVKSSELVSQQDSSPVEVHINKEASSFGIAQTLASSFKTS    561 - 630
FSQISDDRRNPQSPNLQNPTVTLQKIFPNKPASHPMRSHTEVTVTSSNSVDSLPLAKSQPNILVTEVNNE    631 - 700
KDLNESISEEDKQLSKMDQTNKAGEIPQPVSQTGISNSLPDFQNPLSQDSAKSNGFGFNASTIISSKKSP    701 - 770
RVFSRKDTSKMYIPHTDKSNDIKQDKRFTENRKLGSTASLPFIQEHRTPPSFPRTDQGCHQELTVNNEDI    771 - 840
SRIITNNHWSSALTDTQNAQYSKCKLTPGHKTSCDSLDLSSAALPDSSPSKNSSLDAPVVPSTTVFSRRS    841 - 910
PSDKDPSLGEREEKDNAGKNQKNQFIVSHSENQERNDSPVPTHDEVVDVKCHSHSPFRNERGKGKIRHHI    911 - 980
SCIEKLSKTESISVPTSDHRSLIEANQSNSKVSELDTIYCTLPRKSSSFLIHGRQSGSKIMAASLRNGPP    981 - 1050
PFQIKNNVEDAMGNYMLNKFSPSSPESANECSKVLSDSALEAPEATERMTNVKSSGSTSVRKGPLPFLIN   1051 - 1120
RAMSCPSGEPHASTGREGRKKPLTSGMDASELTPRAWERIISPVESDSSVRDCSLTKRQHQKENFQEYTE   1121 - 1190
KEGKMAASRRSVFALSNEDPLPFCSDLSGKERGKTLHKVKTTSTFSVSGDEDNVKCLEVVSIYYTLPRKP   1191 - 1260
SKKFCNLLQQYTQNTNLLIESPQVETETFPNALEKDKQNYSTREQSGTPSCENLKMSVNSDQTLTTENMT   1261 - 1330
AFRLSNRGPLAPTLQEMASVEAAVSLPEEESKAREIFSDNLAKTPLGDSENKKERGKKLQSETLHTSLML   1331 - 1400
QRKNVSEEKSENCQQSINSSNSGPSSLPALSEVNIGNSQTRRSSWECTGSGRAIPFTGSGKCPQKDHTST   1401 - 1470
AVGDGSSGSQPREGRGDIGTNCQKMTNKTLSHSESQVFALTPALHKLQLGEETQSDEPNLESLQSEPREL   1471 - 1540
PQRSQEANMTESRKAEDEMQKSAWDQPSLPEGNKNKTNLDDLVKGENRSSVKHRLAAMSKASRKFPAKDV   1541 - 1610
SPRRHVATIFPQSGSRSGFDHLSLGTVECNPLFPEPTPKSAESIGESRLSENGKHVKKSENLLPITVLPN   1611 - 1680
REPSTHVSNQKSNSISQRHQNEFKNVSESPSKHENSKDVTAAQNLVRESGAPSPITFTSLREAEFSDNQR   1681 - 1750
RLSPPFPLEPAQKSRVSSPLASFLQQQRSASSLEWEPEPHLYRSKSLKSINVHGDLLRKSHPPKVRERHF   1751 - 1820
SESTSIDNALSRLTLGNEFSVNNGYSRRFRSFSELPSCDGNESWAYRSGTKTGPRSAISIYRPIDYGIFG   1821 - 1890
KEQQLAFLENVKRSLTQGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPLNIYE   1891 - 1960
DDPVDSNCDTDTTTDDEYYLDENDKESEL                                            1961 - 1989
//

Text Mined References (17)

PMID Year Title