Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.53
PubTator Score 60.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.700 6.2e-06
osteosarcoma -1.753 4.2e-06
lung cancer 1.800 2.2e-03
group 3 medulloblastoma 1.200 2.5e-04
ovarian cancer 1.300 6.2e-06

 MGI Phenotype (1)

Gene RIF (5)

PMID Text
17545563 Although not required for exosome stability, PM/Scl-100 and PM/Scl-75 are involved in mRNA degradation.
14872500 PM-Scl-75 is the main autoantigen in patients with the polymyositis/scleroderma overlap syndrome.
12788944 The association of the human PM/Scl-75 autoantigen with the exosome is dependent on a newly identified N terminus.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11782436 The mammalian exosome mediates the efficient degradation of mRNAs that contain AU-rich elements, possibly by direct binding of PM/Scl-75 to these RNA regions.

AA Sequence

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR      1 - 70
ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN     71 - 140
HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN    141 - 210
EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG    211 - 280
KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL    281 - 350
EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQ    351 - 420
EKAPSKKPVKRRKKKRAAN                                                       421 - 439
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105744 2013 A SUMO-dependent interaction between Senataxin and the exosome, disrupted in the neurodegenerative disease AOA2, targets the exosome to sites of transcription-induced DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791713 2012 Phosphatase of regenerating liver 2 (PRL2) is essential for placental development by down-regulating PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome 10) and activating Akt protein.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20531386 2010 The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17545563 2007 Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16912217 2006 Sequence-specific RNA binding mediated by the RNase PH domain of components of the exosome.
16455498 2006 Adenylation and exosome-mediated degradation of cotranscriptionally cleaved pre-messenger RNA in human cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
15231747 2004 A protein interaction framework for human mRNA degradation.
14872500 2004 PM-Scl-75 is the main autoantigen in patients with the polymyositis/scleroderma overlap syndrome.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12788944 2003 The association of the human PM/Scl-75 autoantigen with the exosome is dependent on a newly identified N terminus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419256 2002 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11879549 2002 Autoantibodies directed to novel components of the PM/Scl complex, the human exosome.
11812149 2002 Protein-protein interactions of hCsl4p with other human exosome subunits.
11782436 2002 The mammalian exosome mediates the efficient degradation of mRNAs that contain AU-rich elements.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
11110791 2001 Three novel components of the human exosome.
10465791 1999 The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases.
2007859 1991 Molecular characterization of an autoantigen of PM-Scl in the polymyositis/scleroderma overlap syndrome: a unique and complete human cDNA encoding an apparent 75-kD acidic protein of the nucleolar complex.