Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.25
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.305 1.4e-03
malignant mesothelioma 1.400 2.8e-07
glioblastoma multiforme 1.100 2.0e-16
oligodendroglioma 1.100 2.1e-12
osteosarcoma -2.365 8.7e-06
sonic hedgehog group medulloblastoma 1.600 1.1e-05
primitive neuroectodermal tumor 1.200 1.9e-04
X-linked cerebral adrenoleukodystrophy 1.200 4.3e-02
colon cancer 1.100 1.2e-02
acute myeloid leukemia -1.600 4.5e-02
ovarian cancer -1.500 1.3e-05
dermatomyositis 1.100 8.8e-03

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (3)

PMID Text
24989451 homozygous missense mutations cause progressive and lethal neurological disease
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11929972 A protein subunit of human RNase P, Rpp14, and its interacting partner, OIP2, have 3'-->5' exoribonuclease activity.

AA Sequence

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPS      1 - 70
TDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLI     71 - 140
CLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDP    141 - 210
TGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK        211 - 276
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24989451 2014 EXOSC8 mutations alter mRNA metabolism and cause hypomyelination with spinal muscular atrophy and cerebellar hypoplasia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
17545563 2007 Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
16912217 2006 Sequence-specific RNA binding mediated by the RNase PH domain of components of the exosome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419256 2002 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11929972 2002 A protein subunit of human RNase P, Rpp14, and its interacting partner, OIP2, have 3'-->5' exoribonuclease activity.
11812149 2002 Protein-protein interactions of hCsl4p with other human exosome subunits.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
9466265 1998 Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.