Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.11
PubTator Score 25.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 4.5e-02
atypical teratoid / rhabdoid tumor -1.200 1.5e-04
ependymoma -1.100 6.2e-06
gastric cancer 1.100 4.2e-03
glioblastoma -1.100 1.3e-05
group 4 medulloblastoma 1.300 1.3e-03
osteosarcoma 1.754 1.3e-07
ovarian cancer -1.100 3.5e-05
subependymal giant cell astrocytoma -1.095 5.0e-02
X-linked cerebral adrenoleukodystrophy 1.100 3.3e-02

Synonym

Accession Q5RKV6
Symbols p11
EAP4
MTR3
Mtr3p
hMtr3p

Gene

PDB

2NN6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPR      1 - 70
QAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYP     71 - 140
RAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAG    141 - 210
LTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP            211 - 272
//

Text Mined References (16)

PMID Year Title