Property Summary

NCBI Gene PubMed Count 29
PubMed Score 21.10
PubTator Score 7.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 1.4e-05
osteosarcoma 7933 6.3e-04
medulloblastoma, large-cell 6234 4.3e-03
Disease Target Count Z-score Confidence
cat-scratch disease 9 4.351 2.2
Leukemia 88 3.039 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.500 1.4e-05
osteosarcoma 1.249 6.3e-04
medulloblastoma, large-cell 1.200 4.3e-03

Gene RIF (10)

PMID Text
23392705 Further, subcellular co-localization assay showed that the two proteins could co-localize in the cytoplasm of K562 cells, but WT1/CML28 complexes were not detected by using immunoprecipitation.
22174317 HIV-1 Rev interacting protein, exosome component 5 (EXOSC5), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EXOSC5 is increased by RRE
20660080 Results suggest that Rrp46 forms a homodimer separately from exosome complexes and, depending on species, is a structural component of the machinery that cleaves DNA during apoptosis.
19460752 HIV-1 Rev interacting protein, exosome component 5 (EXOSC5), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EXOSC5 is increased by RRE
19460752 Knockdown of exosome component 5 (EXOSC5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of exosome component 5 (EXOSC5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18157497 rAAV/CML28-transduced DCs vaccine may serve as a feasible approach for the treatment of CML28-associated cancers.
16815301 These results in our study indicates gene silencing of SOCS1 remarkably enhanced the cytotoxicity efficiency of CML28 DNA vaccine in DCs.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11812149 association of hCsl4p with the exosome is mediated by protein-protein interactions with hRrp42p and hRrp46p

AA Sequence

MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI      1 - 70
FNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMA     71 - 140
LVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCL    141 - 210
AAAQAASQHVFRFYRESLQRRYSKS                                                 211 - 235
//

Text Mined References (36)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23392705 2013 Interaction of human genes WT1 and CML28 in leukemic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21515746 2011 Modulation of exosome-mediated mRNA turnover by interaction of GTP-binding protein 1 (GTPBP1) with its target mRNAs.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20699273 2010 A link between nuclear RNA surveillance, the human exosome and RNA polymerase II transcriptional termination.
20660080 2010 Structural and biochemical characterization of CRN-5 and Rrp46: an exosome component participating in apoptotic DNA degradation.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19060904 2009 An empirical framework for binary interactome mapping.
18334637 2008 p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein.
18157497 2008 Activation of cytotoxic T lymphocytes against CML28-bearing tumors by dendritic cells transduced with a recombinant adeno-associated virus encoding the CML28 gene.
17185417 2007 The zinc-finger antiviral protein recruits the RNA processing exosome to degrade the target mRNA.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16815301 2006 Induction of CML28-specific cytotoxic T cell responses using co-transfected dendritic cells with CML28 DNA vaccine and SOCS1 small interfering RNA expression vector.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419256 2002 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
12359762 2002 CML28 is a broadly immunogenic antigen, which is overexpressed in tumor cells.
11879549 2002 Autoantibodies directed to novel components of the PM/Scl complex, the human exosome.
11812149 2002 Protein-protein interactions of hCsl4p with other human exosome subunits.
11782436 2002 The mammalian exosome mediates the efficient degradation of mRNAs that contain AU-rich elements.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
11110791 2001 Three novel components of the human exosome.
10465791 1999 The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.