Property Summary

NCBI Gene PubMed Count 28
PubMed Score 85.34
PubTator Score 22.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 2.2e-16
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.221 1.6
Mouth disease 7 3.173 1.6
Obesity 678 3.112 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.098 2.2e-16

Gene RIF (2)

AA Sequence

MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA      1 - 70
LVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN     71 - 140
AATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHL    141 - 210
ERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD                                       211 - 245
//

Text Mined References (33)

PMID Year Title