Property Summary

NCBI Gene PubMed Count 27
PubMed Score 83.18
PubTator Score 22.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.2e-16
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.187 1.6
Obesity 616 3.134 1.6
Mouth disease 6 3.082 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.098 2.2e-16

Synonym

Accession Q9NPD3
Symbols SKI6
p12A
RRP41
Ski6p
RRP41A
Rrp41p
hRrp41p

Gene

PDB

2NN6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
17545563 Knock-down of hRrp41p or hRrp4p but not PM/Scl-100 or PM/Scl-75 leads to codepletion of other subunits.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.

AA Sequence

MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA      1 - 70
LVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVN     71 - 140
AATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHL    141 - 210
ERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD                                       211 - 245
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20699273 2010 A link between nuclear RNA surveillance, the human exosome and RNA polymerase II transcriptional termination.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20531386 2010 The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
20368444 2010 Addition of poly(A) and poly(A)-rich tails during RNA degradation in the cytoplasm of human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
17545563 2007 Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
16912217 2006 Sequence-specific RNA binding mediated by the RNase PH domain of components of the exosome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16341674 2005 Transcriptome analysis of human gastric cancer.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527413 2003 Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.
12788944 2003 The association of the human PM/Scl-75 autoantigen with the exosome is dependent on a newly identified N terminus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419256 2002 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11879549 2002 Autoantibodies directed to novel components of the PM/Scl complex, the human exosome.
11812149 2002 Protein-protein interactions of hCsl4p with other human exosome subunits.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
11110791 2001 Three novel components of the human exosome.
10465791 1999 The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases.