Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.58
PubTator Score 7.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.500 2.6e-02
atypical teratoid / rhabdoid tumor -1.200 3.1e-03
medulloblastoma, large-cell -1.300 9.0e-04
intraductal papillary-mucinous adenoma (... 1.100 3.4e-02
Breast cancer 3.700 2.2e-02
ovarian cancer 1.900 5.2e-04

Synonym

Accession Q8IYI6 B3KU33 Q5TE82
Symbols EXO84
SEC84
Exo84p

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

PMID Text
22761837 We identified interactions between RalA and its effectors sec5 and exo84 in the Exocyst complex as directly necessary for migration and invasion of prostate cancer tumor cells.
20145037 shRNA-mediated knockdown of the Ral effector proteins Sec5 and Exo84, but less so in the case of RalBP1, reduced oncogenic RalGEF-mediated transformation and oncogenic Ras-driven tumorigenic growth of human cells.
14525976 evidence that mammalian exocyst components are present as distinct subcomplexes on vesicles and the plasma membrane and that Ral GTPases regulate the assembly interface of a full octameric exocyst complex through interaction with Sec5 and Exo84

AA Sequence

MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQF      1 - 70
IETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGGEEGVGGAGGRDHLRGQAGFF     71 - 140
STPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMND    141 - 210
CLLVATWLPQRRGMYRYNALYSLDGLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEDT    211 - 280
KRALSEKRRREQEEAAAPRGPPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQ    281 - 350
RDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVEERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR    351 - 420
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAGTDSGCYSAFV    421 - 490
VWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLTFIIHALLVKDIQGALHSYKE    491 - 560
IIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEE    561 - 630
ALKLYFPELHMVLLESLVEIILVAVQHVDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKP    631 - 700
AKQLQDLRNASRLIRVNPESTTSVV                                                 701 - 725
//

Text Mined References (24)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24344185 2013 Endosomal WASH and exocyst complexes control exocytosis of MT1-MMP at invadopodia.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22761837 2012 Sec5 and Exo84 mediate distinct aspects of RalA-dependent cell polarization.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
20145037 2010 Sec5 and Exo84 foster oncogenic ras-mediated tumorigenesis.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525976 2003 Ral GTPases regulate exocyst assembly through dual subunit interactions.
12954101 2003 Immunological characterization of exocyst complex subunits in cell differentiation.
12687004 2003 The exocyst complex is required for targeting of Glut4 to the plasma membrane by insulin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11406615 2001 The brain exocyst complex interacts with RalA in a GTP-dependent manner: identification of a novel mammalian Sec3 gene and a second Sec15 gene.
9655500 1998 Subunit composition, protein interactions, and structures of the mammalian brain sec6/8 complex and septin filaments.
9405631 1997 Subunit structure of the mammalian exocyst complex.