Property Summary

NCBI Gene PubMed Count 29
PubMed Score 55.76
PubTator Score 27.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.100 2.5e-03
psoriasis 1.300 7.4e-05
osteosarcoma -1.502 1.9e-04
posterior fossa group B ependymoma 1.300 6.5e-09
astrocytoma 1.100 1.8e-02
pancreatic ductal adenocarcinoma liver m... 1.052 4.0e-03
lung cancer 1.600 1.3e-04
breast carcinoma 1.300 1.2e-02
diabetes mellitus -1.100 1.7e-03
group 4 medulloblastoma 1.200 2.6e-04
ovarian cancer 2.000 1.5e-05

Gene RIF (7)

PMID Text
26514725 GIV directly and constitutively binds the exocyst complex subunit Exo-70 and also associates with GLUT4-storage vesicles (GSVs) exclusively upon insulin stimulation.
24331928 We show that Exo70, a component of the exocyst complex, undergoes isoform switching mediated by ESRP1, a pre-mRNA splicing factor that regulates epithelial mesenchymal transition.
23948253 Exo70 thus represents a membrane-bending protein that may couple actin dynamics and plasma membrane remodeling for morphogenesis.
23300727 Exo70 is involved in caveolin-1 recycling to the plasma membrane during re-adhesion of the cells to the substratum.
22595671 Exocyst component Exo70 is a direct substrate of the extracellular signal-regulated kinases 1/2, their phosphorylation enhances the binding of Exo70 to other exocyst components and promotes the assembly of the exocyst complex.
22049025 PIPKIgamma and phosphatidyl inositol phosphate pools at nascent E-cadherin contacts cue Exo70 targeting and orient the tethering of exocyst-associated E-cadherin
15705715 BIG2 and Exo70 interact in trans-Golgi network and centrosomes, as well as in exocyst structures or complexes that move along microtubules to the plasma membrane.

AA Sequence

MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL      1 - 70
QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK     71 - 140
LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG    141 - 210
RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLK    211 - 280
QYSQHGLDGKKGGSNLIPLEGLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPL    281 - 350
AGRDDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKA    351 - 420
IVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKE    421 - 490
YNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNL    491 - 560
LSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYI    561 - 630
AEKNLPVFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFL    631 - 700
QKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA                                       701 - 735
//

Text Mined References (34)

PMID Year Title
26514725 2015 GIV/girdin binds exocyst subunit-Exo70 and regulates exocytosis of GLUT4 storage vesicles.
25416956 2014 A proteome-scale map of the human interactome network.
24331928 2013 Exo70 isoform switching upon epithelial-mesenchymal transition mediates cancer cell invasion.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
23948253 2013 Exo70 generates membrane curvature for morphogenesis and cell migration.
23300727 2012 Exo70 subunit of the exocyst complex is involved in adhesion-dependent trafficking of caveolin-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22595671 2012 ERK1/2 regulate exocytosis through direct phosphorylation of the exocyst component Exo70.
22049025 2012 An association between type I? PI4P 5-kinase and Exo70 directs E-cadherin clustering and epithelial polarization.
21639856 2011 Exo70, a subunit of the exocyst complex, interacts with SNEV(hPrp19/hPso4) and is involved in pre-mRNA splicing.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
21034848 2011 EXO70 protein influences dengue virus secretion.
20579884 2010 Salmonella-directed recruitment of new membrane to invasion foci via the host exocyst complex.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18000879 2008 Novel interaction partners of Bardet-Biedl syndrome proteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17086175 2006 Exo70 interacts with the Arp2/3 complex and regulates cell migration.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16148947 2005 Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis.
15705715 2005 Interaction of BIG2, a brefeldin A-inhibited guanine nucleotide-exchange protein, with exocyst protein Exo70.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205466 2004 The mammalian exocyst, a complex required for exocytosis, inhibits tubulin polymerization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12687004 2003 The exocyst complex is required for targeting of Glut4 to the plasma membrane by insulin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11054383 2000 IgA and IgM V(H) repertoires in human colon: evidence for clonally expanded B cells that are widely disseminated.
10610771 1999 Dominance of intrinsic genetic factors in shaping the human immunoglobulin Vlambda repertoire.
10608757 2000 Transient T cell receptor beta-chain variable region-specific expansions of CD4+ and CD8+ T cells during the early phase of pediatric human immunodeficiency virus infection: characterization of expanded cell populations by T cell receptor phenotyping.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.