Property Summary

NCBI Gene PubMed Count 28
PubMed Score 35.83
PubTator Score 13.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 6.8e-04
astrocytic glioma -1.300 1.7e-02
ependymoma -1.400 2.7e-02
glioblastoma -1.500 7.0e-06
intraductal papillary-mucinous carcinoma... 1.100 3.0e-03
medulloblastoma -1.100 4.9e-04
medulloblastoma, large-cell -1.100 2.1e-03
osteosarcoma -1.229 7.6e-03
subependymal giant cell astrocytoma -1.244 2.9e-02

Protein-protein Interaction (10)

Gene RIF (8)

AA Sequence

MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHH      1 - 70
QGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLE     71 - 140
MYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKH    141 - 210
SDKIGETAMKQAQHQKTFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDL    211 - 280
VDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILH    281 - 350
VTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEI    351 - 420
RDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIYI    421 - 490
QVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQA    491 - 560
CKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRAS    561 - 630
GYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELF    631 - 700
ASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNN    701 - 770
IFAQFRKNDRDKQKLIETVVKQLRSLVNGMSQHM                                        771 - 804
//

Text Mined References (31)

PMID Year Title