Property Summary

NCBI Gene PubMed Count 27
PubMed Score 35.06
PubTator Score 13.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 1.7e-02
ependymoma -1.400 2.7e-02
osteosarcoma -1.229 7.6e-03
glioblastoma -1.500 7.0e-06
medulloblastoma -1.100 4.9e-04
medulloblastoma, large-cell -1.100 2.1e-03
intraductal papillary-mucinous carcinoma... 1.100 3.0e-03
adult high grade glioma -1.300 6.8e-04
subependymal giant cell astrocytoma -1.244 2.9e-02

Synonym

Accession Q8TAG9 E9PHI3 Q5VXH8 Q9NZ24
Symbols SEC15
EXOC6A
SEC15L
Sec15p
SEC15L1
SEC15L3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (8)

PMID Text
23435566 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by triggering the switch in binding specificity of Rabin8 from PS to Sec15.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that exocyst complex component 6 (EXOC6) is a Nef-binding protein in Jurkat cells
21044367 Observational study of gene-disease association. (HuGE Navigator)
20944747 coordinated disruption of the Rab11/Sec15 exocyst by anthrax toxins may contribute to toxin-dependent barrier disruption and vascular dysfunction during B. anthracis infection
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16478783 The SEC15 protein plays a crucial role in integrating the signals between Sec4p and the components of the early-polarity-establishment machinery.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15292201 Sec15 has a role as an effector for the Rab11 GTPase in mammalian cells

AA Sequence

MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHH      1 - 70
QGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLE     71 - 140
MYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKH    141 - 210
SDKIGETAMKQAQHQKTFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDL    211 - 280
VDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILH    281 - 350
VTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEI    351 - 420
RDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIYI    421 - 490
QVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQA    491 - 560
CKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRAS    561 - 630
GYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELF    631 - 700
ASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNN    701 - 770
IFAQFRKNDRDKQKLIETVVKQLRSLVNGMSQHM                                        771 - 804
//

Text Mined References (30)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26299925 2015 A potential link between insulin signaling and GLUT4 translocation: Association of Rab10-GTP with the exocyst subunit Exoc6/6b.
25964651 2015 Architectures of multisubunit complexes revealed by a visible immunoprecipitation assay using fluorescent fusion proteins.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24856041 2014 Exocyst complex protein expression in the human placenta.
24563720 2013 Exocyst proteins in cytokinesis: Regulation by Rab11.
23435566 2013 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by switching binding specificity from phosphatidylserine to Sec15.
22685325 2012 Rab11 regulates exocytosis of recycling vesicles at the plasma membrane.
22534017 2012 Proteomic analysis of HIV-1 Nef cellular binding partners reveals a role for exocyst complex proteins in mediating enhancement of intercellular nanotube formation.
22433857 2012 A Rab8 guanine nucleotide exchange factor-effector interaction network regulates primary ciliogenesis.
21850183 2011 Nonsyndromic bilateral and unilateral optic nerve aplasia: first familial occurrence and potential implication of CYP26A1 and CYP26C1 genes.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20944747 2010 Anthrax toxins cooperatively inhibit endocytic recycling by the Rab11/Sec15 exocyst.
20736309 2010 The myotubularin phosphatase MTMR4 regulates sorting from early endosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20224928 2011 Identification of genes associated with chemosensitivity to SAHA/taxane combination treatment in taxane-resistant breast cancer cells.
16478783 2006 The polarity-establishment component Bem1p interacts with the exocyst complex through the Sec15p subunit.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16213214 2005 Centriolin anchoring of exocyst and SNARE complexes at the midbody is required for secretory-vesicle-mediated abscission.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292201 2004 Sec15 is an effector for the Rab11 GTPase in mammalian cells.
15205466 2004 The mammalian exocyst, a complex required for exocytosis, inhibits tubulin polymerization.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15037366 2004 The exocyst complex in polarized exocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11406615 2001 The brain exocyst complex interacts with RalA in a GTP-dependent manner: identification of a novel mammalian Sec3 gene and a second Sec15 gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.