Property Summary

NCBI Gene PubMed Count 47
PubMed Score 39.09
PubTator Score 23.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.500 4.7e-03
atypical teratoid / rhabdoid tumor 1.200 4.0e-03
ependymoma 2.600 5.1e-03
glioblastoma 1.200 9.0e-03
group 4 medulloblastoma 1.600 4.5e-04
medulloblastoma, large-cell 1.500 1.2e-04
oligodendroglioma 2.500 2.3e-03
ovarian cancer 1.200 9.5e-04
tuberculosis 1.500 4.8e-07

Gene RIF (15)

AA Sequence

MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELT      1 - 70
TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLLDEIENIKQVPQK     71 - 140
LEQCMASKHYLSATDMLVSAVESLEGPLLQVEGLSDLRLELHSKKMNLHLVLIDELHRHLYIKSTSRVVQ    141 - 210
RNKEKGKISSLVKDASVPLIDVTNLPTPRKFLDTSHYSTAGSSSVREINLQDIKEDLELDPEENSTLFMG    211 - 280
ILIKGLAKLKKIPETVKAIIERLEQELKQIVKRSTTQVADSGYQRGENVTVENQPRLLLELLELLFDKFN    281 - 350
AVAAAHSVVLGYLQDTVVTPLTQQEDIKLYDMADVWVKIQDVLQMLLTEYLDMKNTRTASEPSAQLSYAS    351 - 420
TGREFAAFFAKKKPQRPKNSLFKFESSSHAISMSAYLREQRRELYSRSGELQGGPDDNLIEGGGTKFVCK    421 - 490
PGARNITVIFHPLLRFIQEIEHALGLGPAKQCPLREFLTVYIKNIFLNQVLAEINKEIEGVTKTSDPLKI    491 - 560
LANADTMKVLGVQRPLLQSTIIVEKTVQDLLNLMHDLSAYSDQFLNMVCVKLQEYKDTCTAAYRGIVQSE    561 - 630
EKLVISASWAKDDDISRLLKSLPNWMNMAQPKQLRPKREEEEDFIRAAFGKESEVLIGNLGDKLIPPQDI    631 - 700
LRDVSDLKALANMHESLEWLASRTKSAFSNLSTSQMLSPAQDSHTNTDLPPVSEQIMQTLSELAKSFQDM    701 - 770
ADRCLLVLHLEVRVHCFHYLIPLAKEGNYAIVANVESMDYDPLVVKLNKDISAIEEAMSASLQQHKFQYI    771 - 840
FEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELL    841 - 910
NLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKDKKITTV          911 - 974
//

Text Mined References (59)

PMID Year Title