Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.41
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.4e-05
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.631 1.8
Meckel syndrome 48 3.015 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.692 1.4e-05

Synonym

Accession Q2M3D2 Q8N9W2 Q96GV2
Symbols XTP7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (4)

PMID Text
23663385 This meta-analysis assesses an association between rs597668 polymorphism in EXOC3L2 and Alzheimer's disease.
22381399 This study suggests that the rs597668 polymorphism near EXOC3L2 may not play a major role in the susceptibility to late-onset Alzheimer's disease in the Northern Han Chinese population.
21566143 exoc3l2 silencing inhibits VEGF receptor 2 phosphorylation and VEGFA-directed migration of cultured endothelial cells.
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHT      1 - 70
ERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAER     71 - 140
LARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQAL    141 - 210
ALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWL    211 - 280
DAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGA    281 - 350
LSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR               351 - 409
//

Text Mined References (12)

PMID Year Title
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
23663385 2013 Association between EXOC3L2 rs597668 polymorphism and Alzheimer's disease.
22381399 2012 Lack of association between rs597668 polymorphism near EXOC3L2 and late-onset Alzheimer's disease in Han Chinese.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21566143 2011 Exocyst complex component 3-like 2 (EXOC3L2) associates with the exocyst complex and mediates directional migration of endothelial cells.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.