Property Summary

NCBI Gene PubMed Count 45
PubMed Score 48.82
PubTator Score 47.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 459 1.1e-04
diabetes mellitus 1683 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Dental caries 157 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
sonic hedgehog group medulloblastoma 1.400 1.1e-04

Gene RIF (15)

AA Sequence

MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKND      1 - 70
KGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIE     71 - 140
KSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSFEQLKMAVTNLKRQANKKSEGSLAYVKGGLS    141 - 210
TFFEAQDALSAIHQKLEADGTEKVEGSMTQKLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRF    211 - 280
KFLFNLPLNIERNIQKGDYDVVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTL    281 - 350
HDQKRYIRYLSDLHASGDPAWQCIGAQHKWILQLMHSCKEGYVKDLKGNPGLHSPMLDLDNDTRPSVLGH    351 - 420
LSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFSETAEKSGQIE    421 - 490
RSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLSIRDGEAKQYGGWEVKCELSGQWLAHAIQTVRLTHE    491 - 560
SLTALEIPNDLLQTIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQ    561 - 630
SLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIH    631 - 700
EDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADP    701 - 770
IVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLM    771 - 840
QCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQ    841 - 910
LTCFQAASSTMMKT                                                            911 - 924
//

Text Mined References (51)

PMID Year Title