Property Summary

NCBI Gene PubMed Count 23
PubMed Score 76.16
PubTator Score 49.82

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (7)

PMID Text
25591774 Ezrin/Sec3 complexes are essential for MUC5AC secretion in NE-stimulated airway epithelial cells and that PIP2 is of critical importance in the formation of these complexes.
23522008 This study portrayed the non-structural function of C protein that helped the flavivirus to nullify the antiviral activity of hSec3p by accelerating its degradation and facilitating efficient binding of elongation factor 1alpha with flaviviral RNA genome.
22534017 HIV-1 Nef interacts with EXOC1 and this interaction is dependent on the GTPase interaction site of PAK2
20160627 HIV-1 Nef interacts with EXOC1 and this interaction is dependent on the GTPase interaction site of PAK2
19889837 Sec3 associates with a subset of Exocyst complexes that are enriched at desmosomes.
19889084 This study identified human Sec3 exocyst protein (hSec3p) as a novel interacting partner of West Nile virus and Dengue virus C protein.
18541705 The exocyst subunits Sec3 and Sec8 interact with the polarity protein IQGAP1 and that this interaction is triggered by active Cdc42 and RhoA, which are essential for matrix degradation.

AA Sequence

MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAW      1 - 70
ALRDLAVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQRYLRKKIDFVNVSSQLLEES     71 - 140
VPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEYAISNAEAFAEKLSRELQVLDGANIQSIMAS    141 - 210
EKQVNILMKLLDEALKEVDQIELKLSSYEEMLQSVKEQMDQISESNHLIHLSNTNNVKLLSEIEFLVNHM    211 - 280
DLAKGHIKALQEGDLASSRGIEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASH    281 - 350
LNNVFVQQGHDQSSTLAQHSVELTLPNHHPFHRDLLRYAKLMEWLKSTDYGKYEGLTKNYMDYLSRLYER    351 - 420
EIKDFFEVAKIKMTGTTKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQSSGNRRSQSS    421 - 490
SLLDMGNMSASDLDVADRTKFDKIFEQVLSELEPLCLAEQDFISKFFKLQQHQSMPGTMAEAEDLDGGTL    491 - 560
SRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPAS    561 - 630
FLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDK    631 - 700
AYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYS    701 - 770
LGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEE    771 - 840
NLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH                    841 - 894
//

Text Mined References (32)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25591774 2015 Ezrin/Exocyst complex regulates mucin 5AC secretion induced by neutrophil elastase in human airway epithelial cells.
24344185 2013 Endosomal WASH and exocyst complexes control exocytosis of MT1-MMP at invadopodia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23817570 2013 A genome-wide association study identifies two new cervical cancer susceptibility loci at 4q12 and 17q12.
23522008 2013 West Nile virus and dengue virus capsid protein negates the antiviral activity of human Sec3 protein through the proteasome pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19889837 2010 Sec3-containing exocyst complex is required for desmosome assembly in mammalian epithelial cells.
19889084 2010 Human Sec3 protein is a novel transcriptional and translational repressor of flavivirus.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541705 2008 The interaction of IQGAP1 with the exocyst complex is required for tumor cell invasion downstream of Cdc42 and RhoA.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15037366 2004 The exocyst complex in polarized exocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525976 2003 Ral GTPases regulate exocyst assembly through dual subunit interactions.
12687004 2003 The exocyst complex is required for targeting of Glut4 to the plasma membrane by insulin.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11493706 2001 The Sec6/8 complex in mammalian cells: characterization of mammalian Sec3, subunit interactions, and expression of subunits in polarized cells.
11406615 2001 The brain exocyst complex interacts with RalA in a GTP-dependent manner: identification of a novel mammalian Sec3 gene and a second Sec15 gene.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9655500 1998 Subunit composition, protein interactions, and structures of the mammalian brain sec6/8 complex and septin filaments.
9405631 1997 Subunit structure of the mammalian exocyst complex.