Property Summary

NCBI Gene PubMed Count 38
PubMed Score 170.13
PubTator Score 28.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-05
astrocytic glioma 1.500 4.2e-03
breast carcinoma 1.200 7.4e-04
ductal carcinoma in situ 1.100 1.8e-02
ependymoma 1.400 1.0e-02
Gaucher disease type 1 1.100 2.3e-02
glioblastoma -1.100 1.7e-08
interstitial cystitis 1.400 1.2e-02
interstitial lung disease 1.500 7.1e-03
intraductal papillary-mucinous adenoma (... -1.200 8.4e-04
intraductal papillary-mucinous carcinoma... -1.500 5.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 3.4e-04
invasive ductal carcinoma 1.064 2.5e-02
malignant mesothelioma -3.500 3.0e-08
non-small cell lung cancer -1.031 1.3e-12
oligodendroglioma 1.500 5.6e-03
osteosarcoma -1.203 6.3e-03
ovarian cancer -1.400 5.1e-06
Pick disease -1.200 4.1e-04
ulcerative colitis 1.100 5.1e-03
Waldenstrons macroglobulinemia -1.317 3.4e-03

Gene RIF (13)

AA Sequence

MSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLK      1 - 70
YNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPSSQRQVQNGPSPDEMDIQRRQ     71 - 140
VMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSCSGPPPPPPPPVPPPPTGATPPPPPPLPAGGA    141 - 210
QGSSHDESSMSGLAAAIAGAKLRRVQRPEDASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRK    211 - 280
AASQSDKPAEKKEDESQMEDPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSP    281 - 350
EAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT        351 - 416
//

Text Mined References (50)

PMID Year Title