Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.46
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (15)

PMID Text
26433934 EVI5 as a strong candidate disease risk gene in the 1p22.1 multiple sclerosis risk locus
25537516 Data show that heat shock transcription factor 1/miR-135b/reversion-inducing-cysteine-rich protein with kazal motifs and ecotropic viral integration site 5 axis provides novel insight into the mechanisms of hepatocellular carcinoma metastasis.
24130709 in HLA-DRB1 positive patients, EVI5 was associated with attacks of greater severity and worse recovery in Multiple sclerosis .
23669355 cellular functions exhibited by the Evi5 family members
20087403 An analysis and fine mapping of GFI-EVI5-RPL5-FAM69A locus, genotyping eight Tag-single nucleotide polymorphisms in 732 multiple sclerosis patients and 974 controls from Spain, was performed.
20087403 Observational study of gene-disease association. (HuGE Navigator)
20008790 Stem cell exhaustion due to Runx1 deficiency is prevented by Evi5 activation in leukemogenesis.
19865102 Observational study of gene-disease association. (HuGE Navigator)
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)
18401352 EVI5 is a risk gene for multiple sclerosis.
18401352 Observational study of gene-disease association. (HuGE Navigator)
17229837 Evi5 is a Rab11 binding protein and that Evi5 may cooperate with Rab11 to coordinate vesicular trafficking, cytokinesis, and cell cycle control independent of GTPase-activating protein function
16764853 Data provide evidence that EVI5 is an essential component of the protein machinery facilitating the final stages of cell septation at the end of mitosis.
16033705 a novel centrosomal protein with a complex expression pattern and subcellular localization, possibly involved in centrosome stability and dynamics

AA Sequence

MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPAL      1 - 70
SPSSPSQLSPDDLELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGR     71 - 140
IVNEWEDVRKKKEKQVKELVHKGIPHHFRAIVWQLLCSAQSMPIKDQYSELLKMTSPCEKLIRRDIARTY    141 - 210
PEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELF    211 - 280
KPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLE    281 - 350
IVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKT    351 - 420
KEMEEQVEIKRLRTENRLLKQRIETLEKHKCSSNYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLD    421 - 490
IEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMN    491 - 560
ELQDELMTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLS    561 - 630
EAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKEEGKLQGQLNKSDSNQYIGELKDQI    631 - 700
AELNHELRCLKGQRGFSGQPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDP    701 - 770
AVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV                                  771 - 810
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26433934 2015 A non-synonymous single-nucleotide polymorphism associated with multiple sclerosis risk affects the EVI5 interactome.
25537516 2015 MicroRNA-135b, a HSF1 target, promotes tumor invasion and metastasis by regulating RECK and EVI5 in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23669355 2013 The Evi5 family in cellular physiology and pathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20087403 2010 Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis.
20008790 2010 Stem cell exhaustion due to Runx1 deficiency is prevented by Evi5 activation in leukemogenesis.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18401352 2008 EVI5 is a risk gene for multiple sclerosis.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17229837 2007 Identification of Rab11 as a small GTPase binding protein for the Evi5 oncogene.
17099728 2007 The EVI5 TBC domain provides the GTPase-activating protein motif for RAB11.
16764853 2006 EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16439210 2006 The evi5 oncogene regulates cyclin accumulation by stabilizing the anaphase-promoting complex inhibitor emi1.
16033705 2005 EVI5 is a novel centrosomal protein that binds to alpha- and gamma-tubulin.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
9618176 1998 NB4S, a member of the TBC1 domain family of genes, is truncated as a result of a constitutional t(1;10)(p22;q21) chromosome translocation in a patient with stage 4S neuroblastoma.