Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.34
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.030 1.8e-02
active ulcerative colitis 1.551 2.7e-03
adult high grade glioma 2.100 2.2e-03
astrocytoma 1.800 3.6e-02
Astrocytoma, Pilocytic 2.400 1.3e-07
cutaneous lupus erythematosus 2.100 1.6e-02
cystic fibrosis 1.592 7.5e-05
glioblastoma 1.600 3.9e-04
head and neck cancer -1.500 2.0e-02
interstitial cystitis 1.900 9.1e-03
invasive ductal carcinoma 1.383 1.1e-03
lung adenocarcinoma -1.091 8.2e-03
lung cancer -2.800 4.7e-05
malignant mesothelioma -1.100 3.1e-05
Multiple myeloma 1.825 7.7e-04
non-small cell lung cancer -1.875 3.7e-15
ovarian cancer -2.100 5.1e-05
periodontitis 1.500 2.0e-30
posterior fossa group A ependymoma 1.100 3.6e-03
primary Sjogren syndrome 2.900 1.6e-05
primitive neuroectodermal tumor 1.200 4.5e-02
psoriasis 2.100 1.8e-04
subependymal giant cell astrocytoma 2.639 2.1e-02

Gene RIF (1)

AA Sequence

MDPKYFILILFCGHLNNTFFSKTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQS      1 - 70
ISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPK     71 - 140
SFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNSIAAILIGV    141 - 210
LLTSMLVAIIIIVLWKCLRKPVLNDQNWAGRSPFADGETPDICMDNIRENEISTKRTSIISLTPWKPSKS    211 - 280
TLLADDLEIKLFESSENIEDSNNPKTEKIKDQVNGTSEDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQ    281 - 350
ESNQSDKPTMTIVSPLPNDSTSLPPSLDCLNQDCGDHKSEIIQSFPPLDSLNLPLPPVDFMKNQEDSNLE    351 - 420
IQCQEFSIPPNSDQDLNESLPPPPAELL                                              421 - 448
//

Text Mined References (16)

PMID Year Title