Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.51
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.500 1.8e-04
cutaneous lupus erythematosus 2.000 3.0e-03
cystic fibrosis 3.185 1.3e-07
Down syndrome 1.600 3.2e-03
ependymoma -2.700 3.8e-02
glioblastoma multiforme -1.100 1.4e-05
group 3 medulloblastoma -3.700 8.5e-05
head and neck cancer -1.200 2.5e-02
head and neck cancer and chronic obstruc... 1.100 5.6e-03
interstitial cystitis 1.900 4.4e-03
intraductal papillary-mucinous carcinoma... -1.800 1.9e-02
invasive ductal carcinoma 2.202 1.1e-03
lung adenocarcinoma -1.199 7.7e-04
lung cancer -1.300 3.6e-03
lung carcinoma -2.000 3.8e-18
malignant mesothelioma 1.400 2.0e-06
medulloblastoma, large-cell -3.800 5.7e-05
Multiple myeloma 1.483 5.4e-03
non-small cell lung cancer -1.452 8.0e-12
oligodendroglioma -2.200 4.5e-02
ovarian cancer -2.000 3.0e-05
primary Sjogren syndrome 2.300 5.9e-05
primitive neuroectodermal tumor -1.600 1.6e-02
progressive supranuclear palsy -2.200 1.8e-02
sarcoidosis 1.800 5.0e-02
ulcerative colitis 2.800 6.0e-06
Waldenstrons macroglobulinemia 1.546 2.0e-02

Gene RIF (1)

AA Sequence

MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDY      1 - 70
KGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLI     71 - 140
IIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQ    141 - 210
STGVLTATRERKDEEGTEKLTNKQIG                                                211 - 236
//

Text Mined References (15)

PMID Year Title