Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 197.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.200 3.4e-02
atypical teratoid / rhabdoid tumor -1.600 5.1e-04
Breast cancer -2.100 1.7e-08
gastric cancer 1.100 4.3e-04
group 3 medulloblastoma -2.000 5.1e-05
intraductal papillary-mucinous adenoma (... 1.200 1.4e-02
invasive ductal carcinoma -1.600 2.1e-03
medulloblastoma, large-cell -2.800 8.9e-07
nasopharyngeal carcinoma -1.400 1.7e-04
non-small cell lung cancer -1.356 1.2e-10
oligodendroglioma -1.300 3.5e-02
osteosarcoma -2.557 3.1e-04
ovarian cancer -1.900 3.7e-03
urothelial carcinoma -2.200 4.5e-06

Gene RIF (3)

AA Sequence

MLLPGRARQPPTPQPVQHPGLRRQVEPPGQLLRLFYCTVLVCSKEISALTDFSGYLTKLLQNHTTYACDG      1 - 70
DYLNLQCPRHSTISVQSAFYGQDYQMCSSQKPASQREDSLTCVAATTFQKVLDECQNQRACHLLVNSRVF     71 - 140
GPDLCPGSSKYLLVSFKCQPNELKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPP    141 - 210
FDCLSYSALQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLK    211 - 280
QKDGEYGINFDPSGSKVLRKDGILVSNSLAAFAYIRAHPERAALLFVSSVCIGLALTLCALVIRESCAKD    281 - 350
FRDLQLGREQLVPGSDKVEEDSEDEEEEEDPSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQII    351 - 420
QEIWMNSGLDTSLPRNMGQFY                                                     421 - 441
//

Text Mined References (10)

PMID Year Title