Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.64
PubTator Score 10.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24257118 The adenovirus-mediated increase of FAM176A inhibited the growth of the tumor cells.
23098460 Low TMEM166 mRNA and protein expression is associated with esophageal squamous cell carcinoma.
22495369 TMEM166 expression was widely down-regulated in the cancer tissues.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17492404 TMEM166 is a novel regulator involved in both autophagy and apoptosis.

AA Sequence

MRLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAALVIRISCHTDCRRRPGKK      1 - 70
FLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLNKNVFTSAEELERAQRLEERERIIREIWMNGQP     71 - 140
EVPGTRSLNRYY                                                              141 - 152
//

Text Mined References (18)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25363290 2015 CCAAT/enhancer binding protein ? predicts poorer prognosis and prevents energy starvation-induced cell death in hepatocellular carcinoma.
24257118 2014 Adenovirus vector-mediated FAM176A overexpression induces cell death in human H1299 non-small cell lung cancer cells.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23098460 2012 Transmembrane protein 166 expression in esophageal squamous cell carcinoma in Xinjiang, China.
22495369 2013 Expression of TMEM166 protein in human normal and tumor tissues.
22227058 2012 Transmembrane protein 166 regulates autophagic and apoptotic activities following focal cerebral ischemic injury in rats.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19029833 2009 High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17492404 2007 TMEM166, a novel transmembrane protein, regulates cell autophagy and apoptosis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.