Property Summary

NCBI Gene PubMed Count 13
PubMed Score 36.93
PubTator Score 21.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.1e-03
sarcoidosis 368 6.0e-03
active Crohn's disease 918 7.1e-03
active ulcerative colitis 477 1.4e-02
Multiple Sclerosis 498 1.6e-02

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.131 4.1e-03
active Crohn's disease 1.674 7.1e-03
active ulcerative colitis 1.466 1.4e-02
Multiple Sclerosis 1.900 1.6e-02
sarcoidosis 1.800 6.0e-03

Gene RIF (3)

PMID Text
26335051 TEL2 plays a key role in nasopharyngeal carcinoma metastasis by directly down-regulating SERPINE1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15743832 Human TEL2 augments the proliferation and survival of normal mouse B cells and dramatically accelerates lymphoma development in Emu-Myc transgenic mice.

AA Sequence

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY      1 - 70
SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP     71 - 140
VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA    141 - 210
MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS    211 - 280
RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP             281 - 341
//

Text Mined References (13)

PMID Year Title
26335051 2015 TEL2 suppresses metastasis by down-regulating SERPINE1 in nasopharyngeal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15743832 2005 The novel ETS factor TEL2 cooperates with Myc in B lymphomagenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12588862 2003 The human L(3)MBT polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11108721 2001 Tel-2 is a novel transcriptional repressor related to the Ets factor Tel/ETV-6.
11032031 2000 Characterization of a novel ETS gene, TELB, encoding a protein structurally and functionally related to TEL.
10828014 2000 Identification and characterization of a new human ETS-family transcription factor, TEL2, that is expressed in hematopoietic tissues and can associate with TEL1/ETV6.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.