Property Summary

NCBI Gene PubMed Count 51
PubMed Score 156.70
PubTator Score 42.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 2.5e-03
psoriasis -2.300 1.4e-04
osteosarcoma 2.448 1.9e-04
posterior fossa group B ependymoma -1.900 1.7e-08
glioblastoma 1.700 2.5e-03
medulloblastoma -1.400 1.2e-02
medulloblastoma, large-cell -2.500 2.0e-03
primitive neuroectodermal tumor -1.900 3.9e-02
primary pancreatic ductal adenocarcinoma -1.831 8.0e-04
lung adenocarcinoma -1.300 3.0e-10
pediatric high grade glioma 1.200 1.5e-02
pilocytic astrocytoma 1.100 2.5e-03
lung carcinoma -1.100 1.1e-05
Breast cancer -1.900 3.5e-15
mucosa-associated lymphoid tissue lympho... 1.762 3.5e-02
ovarian cancer 1.700 1.0e-05
pituitary cancer -1.700 1.0e-04
pancreatic cancer -1.700 6.6e-05

Protein-protein Interaction (4)

Gene RIF (37)

PMID Text
26289026 ERM proteins contribute toward accelerated CD44 shedding by MT1-MMP through ERM protein-mediated interactions between their cytoplasmic tails.
25924802 Increase of ETV5 protein expression is associated with endometrial cancer invasion.
25801911 Our results reveal a novel ERM-based spatial mechanism that is coopted by DLBCL cells to sustain tumor cell growth and survival.
25203299 developed a novel RNA in situ hybridization-based assay for the in situ detection of ETV1, ETV4, and ETV5 in formalin-fixed paraffin-embedded tissues from prostate needle biopsies, prostatectomy, and metastatic PCa specimens using RNA probes
25172658 Snail regulates the motility and invasiveness of oral cancer cells via RhoA/Cdc42/p-ERM pathway.
24756106 there is a higher expression of ERM/ETV5 in early stages of endometrioid endometrial carcinomas
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of ets variant 5 (ETV5) in primary human brain microvascular endothelial cells
22968857 This data suggests that ETV5 has a significant role in regulating MMP2 expression and therefore matrix resorption in human chondrosarcoma, and thus may be a targetable upstream effector of the metastatic cascade in this cancer.
22771031 The homozygous +48845 G>T (TT allele) variant confers a higher risk for male infertility associated with nonobstructive azoospermia and Sertoli cell only syndrome in Australian men.
22589409 we found that the downregulation of ETV5 reduced the expression of the oncogenic transcription factor FOXM1.
22425584 Review evidence for a role of ETV1, 4 and 5 as oncoproteins and describe modes of their action.
22266854 we propose ETV5-transcriptional regulation of the EMT process through a crosstalk with the tumor surrounding microenvironment, as a principal event initiating EC invasion.
21689625 Pea3 and Erm, but not Er81, play an important role in the progression of esophageal squamous cell carcinoma
21520040 Upregulation of ETV5 induced the expression of cell adhesion molecules and enhanced cell survival in a spheroid model.
20970160 results indicate concurrent mechanisms in expression of MMP-2 and -9, RUNX1/AML1 and ETV5/ERM, and several basement membrane components, which likely associate with the invasive stage of endometrioid endometrial and ovarian endometrioid carcinoma.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20647002 The flexible nature of transactivation domain may be instrumental for ERM recognition and binding to diverse molecular partners.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19746409 Observational study of gene-disease association. (HuGE Navigator)
19692490 Observational study of gene-disease association. (HuGE Navigator)
18172298 A TMPRSS2:ETV5 gene fusion was identified in prostate cancer.
17638886 ERM/ETV5 up-regulation activates MMP-2 and thus has a role during myometrial infiltration in endometrial cancer
17489097 Testing various shorter fragments of ERM as bait indicated that the region essential for binding CHD3/ZFH is within the amino acid region 96-349, which contains the central inhibitory DNA-binding domain (CIDD) of ERM
16615918 analysis of NHERF recognition by ERM proteins
16613858 Erm is involved in SP-C regulation, which results from an interaction with TTF-1
15857832 ERM is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity
15652352 CD44-mediated hyaluronan binding in myeloid cells is regulated by phosphorylated ERM and the actin cytoskeleton.
15620692 The erm gene expression is regulated by the conventional PKC (cPKC) pathway.
15534105 ERM has a role in progression of breast cancer
12387735 functional role for the ERMs (ezrin/radixin/moesin) as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases

AA Sequence

MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFV      1 - 70
PDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTP     71 - 140
LSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPEN    141 - 210
QYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG    211 - 280
PPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVK    281 - 350
QEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD    351 - 420
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSP    421 - 490
AYLLDMDRCSSLPYAEGFAY                                                      491 - 510
//

Text Mined References (55)

PMID Year Title
26289026 2015 MT1-MMP recognition by ERM proteins and its implication in CD44 shedding.
25924802 2015 Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.
25801911 2015 Identification of Ezrin-Radixin-Moesin proteins as novel regulators of pathogenic B-cell receptor signaling and tumor growth in diffuse large B-cell lymphoma.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25203299 2014 Novel RNA hybridization method for the in situ detection of ETV1, ETV4, and ETV5 gene fusions in prostate cancer.
25172658 2014 Snail regulates the motility of oral cancer cells via RhoA/Cdc42/p-ERM pathway.
24756106 2014 ERM/ETV5 and RUNX1/AML1 expression in endometrioid adenocarcinomas of endometrium and association with neoplastic progression.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22968857 2013 ETV5 as a regulator of matrix metalloproteinase 2 in human chondrosarcoma.
22771031 2012 Genetic variants in the ETV5 gene in fertile and infertile men with nonobstructive azoospermia associated with Sertoli cell-only syndrome.
22589409 2012 Analysis of gene expression regulated by the ETV5 transcription factor in OV90 ovarian cancer cells identifies FOXM1 overexpression in ovarian cancer.
22425584 2012 ETV1, 4 and 5: an oncogenic subfamily of ETS transcription factors.
22266854 2012 ETV5 cooperates with LPP as a sensor of extracellular signals and promotes EMT in endometrial carcinomas.
21689625 2011 The role of Pea3 group transcription factors in esophageal squamous cell carcinoma.
21520040 2012 ETV5 transcription factor is overexpressed in ovarian cancer and regulates cell adhesion in ovarian cancer cells.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20970160 2011 Matrix metalloproteinase-2 and matrix metalloproteinase-9 codistribute with transcription factors RUNX1/AML1 and ETV5/ERM at the invasive front of endometrial and ovarian carcinoma.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20647002 2010 Solution structure of the N-terminal transactivation domain of ERM modified by SUMO-1.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20520848 2010 Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19746409 2010 Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
19692490 2009 Obesity genes identified in genome-wide association studies are associated with adiposity measures and potentially with nutrient-specific food preference.
19443906 2009 Proteomic approach to ETV5 during endometrial carcinoma invasion reveals a link to oxidative stress.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18172298 2008 Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer.
17638886 2007 ERM/ETV5 up-regulation plays a role during myometrial infiltration through matrix metalloproteinase-2 activation in endometrial cancer.
17489097 2007 The C-terminal region of CHD3/ZFH interacts with the CIDD region of the Ets transcription factor ERM and represses transcription of the human presenilin 1 gene.
17126306 2007 Analysis of transcriptional modulation of the presenilin 1 gene promoter by ZNF237, a candidate binding partner of the Ets transcription factor ERM.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16615918 2006 Structural basis for NHERF recognition by ERM proteins.
16613858 2006 Erm/thyroid transcription factor 1 interactions modulate surfactant protein C transcription.
15857832 2005 SUMO modification of the Ets-related transcription factor ERM inhibits its transcriptional activity.
15652352 2005 Regulation of hyaluronan binding by F-actin and colocalization of CD44 and phosphorylated ezrin/radixin/moesin (ERM) proteins in myeloid cells.
15620692 2005 Expression of the Ets transcription factor Erm is regulated through a conventional PKC signaling pathway in the Molt4 lymphoblastic cell line.
15534105 2004 Prognostic value of ERM gene expression in human primary breast cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387735 2002 ITAM-based interaction of ERM proteins with Syk mediates signaling by the leukocyte adhesion receptor PSGL-1.
12036888 2002 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11509567 2001 Identification and characterization of a novel androgen receptor coregulator ARA267-alpha in prostate cancer cells.
8941378 1996 Assignment of the ERM gene (ETV5) coding for the ets-related protein to human chromosome band 3q28 by in situ hybridization.
8661127 1996 Genomic organization of the human ERM (ETV5) gene, a PEA3 group member of ETS transcription factors.
8152800 1994 Molecular cloning and characterization of human ERM, a new member of the Ets family closely related to mouse PEA3 and ER81 transcription factors.
7559555 1995 ERM, a PEA3 subfamily of Ets transcription factors, can cooperate with c-Jun.