Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1687.11
PubTator Score 82.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.100 1.9e-02
medulloblastoma, large-cell 1.300 1.4e-03
primary pancreatic ductal adenocarcinoma 1.524 4.4e-03
tuberculosis -1.300 1.7e-06
intraductal papillary-mucinous neoplasm ... 1.900 1.3e-02
lung cancer -1.100 1.3e-02
diabetes mellitus -1.200 3.4e-03
acute myeloid leukemia 1.500 5.7e-03
ulcerative colitis 1.200 1.6e-06
ovarian cancer 1.100 3.1e-02
chronic rhinosinusitis -1.001 8.2e-03
pancreatic cancer 1.700 2.8e-03

Gene RIF (5)

PMID Text
23329352 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
18976975 Knockdown of ets variant 3 (ETV3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18025162 The ETV3 expression was strongly induced by the STAT3 pathway regulated by IL-10 but not by STAT3 signaling activated by IL-6, which cannot activate the anti-inflammatory signaling pathway.
17525531 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
14754893 PE-1/METS is an antiproliferative Ets repressor factor induced by CREB-1/CREM-1 during macrophage differentiation

AA Sequence

MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPD      1 - 70
EVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSA     71 - 140
PPVPTASSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVS    141 - 210
SRNAIGGGGIGHQKRKPDIMLPLFARPGMYPDPHSPFAVSPIPGRGGVLNVPISPALSLTPTIFSYSPSP    211 - 280
GLSPFTSSSCFSFNPEEMKHYLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEESTQFSIKLQPPP    281 - 350
VGRKNRERVESSEESAPVTTPTMASIPPRIKVEPASEKDPESLRQSAREKEEHTQEEGTVPSRTIEEEKG    351 - 420
TIFARPAAPPIWPSVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELS    421 - 490
KSGKFLWNGSGPQGLATAAADA                                                    491 - 512
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23329352 2013 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025162 2007 Cutting edge: A transcriptional repressor and corepressor induced by the STAT3-regulated anti-inflammatory signaling pathway.
17525531 2007 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14754893 2004 PE-1/METS, an antiproliferative Ets repressor factor, is induced by CREB-1/CREM-1 during macrophage differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12007404 2002 An induced Ets repressor complex regulates growth arrest during terminal macrophage differentiation.
8020980 1994 PE-1, a novel ETS oncogene family member, localizes to chromosome 1q21-q23.