Property Summary

NCBI Gene PubMed Count 8
PubMed Score 42.31
PubTator Score 14.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-03

Synonym

Accession O00321 A6NFN5 B3KUL0 B9EIN1 Q9UEA0
Symbols ER71
ETSRP71

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25540418 ets variant 2 (ETV2) alone directly converts primary human adult skin fibroblasts into functional vascular endothelial cells.
18270322 identify human Etv2/ER71 and mouse ER71 proteins as functional orthologs of Etsrp

AA Sequence

MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALL      1 - 70
HPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEAT     71 - 140
SWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQ    141 - 210
SSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARL    211 - 280
WGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ            281 - 342
//

Text Mined References (9)

PMID Year Title
25540418 2015 ETS transcription factor ETV2 directly converts human fibroblasts into functional endothelial cells.
18270322 2008 Interplay among Etsrp/ER71, Scl, and Alk8 signaling controls endothelial and myeloid cell formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12087183 2002 Functional analysis of the transcription factor ER71 and its activation of the matrix metalloproteinase-1 promoter.
1340465 1992 Specificities of protein-protein and protein-DNA interaction of GABP alpha and two newly defined ets-related proteins.