Property Summary

NCBI Gene PubMed Count 97
PubMed Score 244.89
PubTator Score 173.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 4.46645771172455E-15
Breast cancer 3099 1.13362556569408E-10
pituitary cancer 1972 2.54650835746683E-10
juvenile dermatomyositis 1189 1.05163386546562E-8
lung adenocarcinoma 2714 8.22878624096196E-8
atypical teratoid / rhabdoid tumor 4369 8.82376783404093E-8
acute quadriplegic myopathy 1157 1.316632022419E-7
ovarian cancer 8492 1.8699270488068E-7
medulloblastoma, large-cell 6234 5.91013174208694E-5
medulloblastoma 1524 6.35320247572993E-5
primitive neuroectodermal tumor 3031 4.59353087933507E-4
urothelial carcinoma 318 5.77993824093194E-4
dermatomyositis 967 0.00100454998894123
glioblastoma 5572 0.00112464742246241
psoriasis 6685 0.00215942622984542
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0024197335486007
tuberculosis 1563 0.00297491949985357
adrenocortical carcinoma 1427 0.0030181577078442
osteosarcoma 7933 0.00361506490159414
invasive ductal carcinoma 2950 0.00423429441569321
colon cancer 1475 0.00458896820012405
pancreatic cancer 2300 0.00459462399654525
astrocytic glioma 2241 0.00507743568516367
primary pancreatic ductal adenocarcinoma 1271 0.00674575586947763
aldosterone-producing adenoma 664 0.00861524482944078
pediatric high grade glioma 2712 0.0105043924352004
oligodendroglioma 2849 0.0152704084183788
acute myeloid leukemia 785 0.0162054301791193
Barrett's esophagus 185 0.0240365765991713
gastric carcinoma 832 0.0287229666847518
active ulcerative colitis 477 0.0480371203808145
Disease Target Count Z-score Confidence
lung cancer 4473 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.051 2.0
Disease Target Count Z-score Confidence
Frey Syndrome 4 4.211 2.1

Expression

  Differential Expression (32)

Disease log2 FC p
urothelial carcinoma -1.500 0.001
astrocytic glioma -1.400 0.005
oligodendroglioma -1.300 0.015
Barrett's esophagus 1.100 0.024
psoriasis 1.200 0.002
glioblastoma -1.900 0.001
osteosarcoma -1.686 0.004
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.900 0.000
autosomal dominant Emery-Dreifuss muscul... 1.403 0.002
juvenile dermatomyositis 1.082 0.000
acute quadriplegic myopathy 1.985 0.000
adrenocortical carcinoma -1.255 0.003
tuberculosis -1.100 0.003
primary pancreatic ductal adenocarcinoma 1.379 0.007
non-small cell lung cancer -1.364 0.000
colon cancer 2.500 0.005
lung cancer -3.800 0.000
active ulcerative colitis 1.127 0.048
lung adenocarcinoma -1.800 0.000
pediatric high grade glioma -1.200 0.011
aldosterone-producing adenoma -1.121 0.009
Breast cancer -1.500 0.000
gastric carcinoma 1.600 0.029
invasive ductal carcinoma -1.600 0.004
acute myeloid leukemia 1.100 0.016
ovarian cancer -2.100 0.000
pituitary cancer -2.300 0.000
pancreatic cancer 1.700 0.005
dermatomyositis 1.400 0.001

Synonym

Accession P15036 A6NM68 D3DSH6 Q53Y89
Symbols ETS2IT1

Gene

PANTHER Protein Class (1)

PDB

4BQA   4MHV  

  Ortholog (12)

Gene RIF (61)

PMID Text
27100087 RNA-seq evidence of biallelic expression of ETS2 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of ETS2 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
26926107 ETS2, HNF4A and JUNB are synergistic master regulators of epithelial-to-mesenchymal transition in cancer.
26389665 Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation.
26365772 c-ETS transcription factors appear to be key regulators of MCM4 origin where c-ETS2 seems to promote DNA replication whereas c-ETS1 functions as a negative regulator.
26274316 ATO treatment upregulated Ets-2 and miR-126 expression in HUVECs.
25726912 ETS-1/ETS-2 and C/EBPalpha could interact with corresponding binding sites.
25680408 These data suggested that Ets-2, a genuine cancer-specific transcription factor, is actively involved in EGFR kinase-induced hTERT overexpression pathway in lung cancer cells.
25670864 The crystal structure of a DNA complex of the Ets-2 Ets domain.
24362029 identified Ets2 as a key novel regulator in both the positive and negative control of miR-155 in the inflammatory response.
23977064 The data reveals a key function for Ets2 in tumor fibroblasts in signaling to endothelial cells to promote tumor angiogenesis.
More...

AA Sequence

MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPL      1 - 70
LTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLC     71 - 140
NLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQ    141 - 210
NYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPE    211 - 280
NGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP    281 - 350
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG    351 - 420
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED                         421 - 469
//

Text Mined References (98)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26926107 2016 Synergistic action of master transcription factors controls epithelial-to-mesenchymal transition.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26389665 2015 Non-canonical NF-?B signalling and ETS1/2 cooperatively drive C250T mutant TERT promoter activation.
26365772 2015 c-ETS transcription factors play an essential role in the licensing of human MCM4 origin of replication.
26274316 2015 VEGFA Expression Is Inhibited by Arsenic Trioxide in HUVECs through the Upregulation of Ets-2 and miRNA-126.
25726912 2015 Transcriptional regulation of the apolipoprotein F (ApoF) gene by ETS and C/EBP? in hepatoma cells.
25680408 2015 Epidermal growth factor activates telomerase activity by direct binding of Ets-2 to hTERT promoter in lung cancer cells.
25670864 2015 Structural insights into the autoregulation and cooperativity of the human transcription factor Ets-2.
25117710 2014 Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor.
More...