Property Summary

NCBI Gene PubMed Count 106
PubMed Score 253.27
PubTator Score 173.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Mammary Neoplasms 403
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
lung cancer 4607 0.0 2.90224777583493E-4
Disease Target Count Z-score Confidence
Cancer 2388 4.096 2.0
Disease Target Count Z-score Confidence
Down syndrome 480 5.483 2.7
Frey syndrome 4 4.231 2.1

Expression

  Differential Expression (32)

Disease log2 FC p
lung cancer -2.800 2.9e-04
active ulcerative colitis 1.127 4.8e-02
acute myeloid leukemia 1.100 1.6e-02
acute quadriplegic myopathy 1.412 5.5e-06
adrenocortical carcinoma -1.255 3.0e-03
adult high grade glioma -1.200 2.4e-02
aldosterone-producing adenoma -1.121 8.6e-03
astrocytic glioma -1.400 5.1e-03
atypical teratoid / rhabdoid tumor -2.700 8.8e-08
autosomal dominant Emery-Dreifuss muscul... 1.297 4.3e-03
Barrett's esophagus 1.100 2.4e-02
Breast cancer -1.500 1.1e-10
colon cancer 2.500 4.6e-03
dermatomyositis 1.400 1.0e-03
gastric carcinoma 1.400 3.5e-02
glioblastoma -1.900 1.1e-03
group 4 medulloblastoma -1.900 8.0e-04
invasive ductal carcinoma -1.600 4.2e-03
juvenile dermatomyositis 1.082 1.1e-08
lung adenocarcinoma -1.300 8.3e-15
medulloblastoma, large-cell -2.200 5.9e-05
non-small cell lung cancer -1.364 4.5e-15
oligodendroglioma -1.300 1.5e-02
osteosarcoma -1.686 3.6e-03
ovarian cancer -2.100 1.9e-07
pancreatic cancer 1.100 5.6e-03
pituitary cancer -2.300 2.5e-10
primary pancreatic ductal adenocarcinoma 1.379 6.7e-03
primitive neuroectodermal tumor -1.900 4.6e-04
psoriasis 1.200 2.2e-03
tuberculosis -1.100 3.0e-03
urothelial carcinoma -1.300 2.5e-02

Protein-protein Interaction (1)

Gene RIF (68)

AA Sequence

MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPL      1 - 70
LTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLC     71 - 140
NLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQ    141 - 210
NYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPE    211 - 280
NGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP    281 - 350
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG    351 - 420
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED                         421 - 469
//

Text Mined References (107)

PMID Year Title