Property Summary

NCBI Gene PubMed Count 309
PubMed Score 759.97
PubTator Score 575.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.100 5.0e-02
adult high grade glioma 1.500 2.0e-03
Astrocytoma, Pilocytic 1.500 6.9e-07
atypical teratoid/rhabdoid tumor 1.200 3.3e-03
Duchenne muscular dystrophy 1.095 1.2e-05
ependymoma 1.200 2.8e-04
gastric cancer -1.100 2.3e-02
glioblastoma 1.400 1.5e-04
juvenile dermatomyositis 1.573 1.1e-10
lung cancer -1.600 6.2e-04
lung carcinoma -1.100 4.4e-10
non-small cell lung cancer -1.073 1.0e-10
oligodendroglioma 1.900 1.8e-02
osteosarcoma 1.367 3.3e-03
ovarian cancer -1.400 2.5e-03
pancreatic cancer 2.000 1.7e-03
primary pancreatic ductal adenocarcinoma 2.162 2.3e-04
primary Sjogren syndrome 2.300 1.0e-04
subependymal giant cell astrocytoma 2.020 5.9e-03
ulcerative colitis 1.600 3.6e-04

PDB (20)

Gene RIF (253)

AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR      1 - 70
QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY     71 - 140
QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL    141 - 210
RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV    211 - 280
PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC    281 - 350
QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS    351 - 420
LLGYTPEELHAMLDVKPDADE                                                     421 - 441
//

Text Mined References (317)

PMID Year Title