Property Summary

NCBI Gene PubMed Count 288
PubMed Score 732.46
PubTator Score 575.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric carcinoma 1.300 1.6e-02
oligodendroglioma 1.900 1.8e-02
glioblastoma 2.000 8.9e-09
osteosarcoma 1.367 3.3e-03
posterior fossa group A ependymoma 1.600 3.5e-07
Duchenne muscular dystrophy 1.095 1.2e-05
juvenile dermatomyositis 1.573 1.1e-10
primary pancreatic ductal adenocarcinoma 2.162 2.3e-04
non-small cell lung cancer -1.073 1.0e-10
lung cancer -1.600 6.2e-04
pediatric high grade glioma 1.900 1.7e-06
atypical teratoid/rhabdoid tumor 1.200 3.3e-03
pilocytic astrocytoma 2.200 5.6e-08
primary Sjogren syndrome 2.300 1.0e-04
subependymal giant cell astrocytoma 2.020 5.9e-03
lung carcinoma -1.100 4.4e-10
acute myeloid leukemia -1.100 5.0e-02
ulcerative colitis 1.600 3.6e-04
ovarian cancer -1.400 2.5e-03
pancreatic cancer 2.000 1.7e-03

Protein-protein Interaction (3)

Gene RIF (233)

PMID Text
26938745 NR4As regulate gene transcription primarily through interaction with distal enhancers that are co-enriched for NR4A1 and ETS transcription factor motifs
26743285 the markers Ets-1 and APAF-1 relative to p53, Ki-67 and PTEN expression in colon adenomas/polyps, were investigated.
26389665 Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation.
26365772 c-ETS transcription factors appear to be key regulators of MCM4 origin where c-ETS2 seems to promote DNA replication whereas c-ETS1 functions as a negative regulator.
26296467 Fentanyl showed anti-tumor like effects on CRC cells, including less cell clone formation and inhibited cell migration and invasion.
26241881 A significant positive correlation was seen between ETS-1 rs73013527 and RA susceptibility. Carriers of the haplotype CCT or TCT for rs4937333, rs11221332 and rs73013527 had decreased risk. No effect was seen for rs10893872, rs4937333 and rs11221332.
26195629 Data show that proto-oncogene protein ETS1 transiently forms dimers as a consequence of interacting with any DNA sequence.
26177288 MiR-324-5p suppresses hepatocellular carcinoma cell invasion by counteracting extracellular matrix degradation through post-transcriptionally downregulating ETS1 and SP1.
26150526 These observations suggest that not only ERK1/2 but also Akt activity is essential to maintain Ets-1 in an active state.
26122040 By investigating the role of ERa in the ETS-1 activity regulation, we demonstrated that ERalpha may be a novel ETS-1 co-activator and thus a potential therapeutic target in human neuroblastoma treatment
26072332 Expression of the ETS transcription factor GABPalpha is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
26039128 results showed that there were significant associations for rs1128334 with autoimmune diseases risk in 5 genetic models, both in pooled analysis and in systemic lupus erythematous (SLE) subgroup, and in 3 genetic models of the uveitis subgroup.
25929465 our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cells
25912876 Taken together, our findings indicate an important role for miR-129-5p in the molecular etiology of invasive HCC and suggest that miR-129-5p could have potential therapeutic applications in HCC.
25893733 Manipulation of the miR-221/222-Ets-1-p21 pathway may offer a novel strategy for treatment of endothelial apoptosis.
25885538 ERG overexpression drives migration of prostate cells with low levels of RAS/ERK signaling, while ETS1 has a similar function only when RAS/ERK signaling is high
25880398 Results provide evidence of an Rb1-dependent Ets1-Zeb1 amplification loop in thymocytes differentiation and tumor invasion.
25865496 We propose a model in which the risk allele of rs6590330 is associated with decreased ETS1 expression and increases systemic lupus erythematosus risk by enhancing the binding of pSTAT1.
25776481 As miR-377 was found to be differentially expressed in clear cell renal carcinoma, and in light of the apparent central role of ETS1 in tumor development, these results indicate that miR-377 could be useful for diagnostics, prognostics and therapeutics.
25726912 Direct interactions between C/EBPalpha and ETS-1 were important for high liver-specific expression of ApoF.
25651508 Findings strongly suggest a critical role for ETS1 in the induction of human villus cytotrophoblast differentiation.
25639877 Ets1 expressing cells are specifically targeted by a novel RNA aptamer for targeted delivery of a nano-formulation.
25633318 Demonstrate that TrkB protects endothelial integrity during atherogenesis by promoting Ets1-mediated VE-cadherin expression and plays a previously unknown protective role in the development of coronary artery disease.
25531327 discover a pathway where ETS1 advances melanoma through the expression of MET via PAX-dependent and -independent mechanisms
25421630 data showed that ETS-1 functions as a regulator of epithelial-mesenchymal transition in pancreatic cancer cells, and suggest that analysis of ETS-1 expression levels may provide an avenue for evaluating prognosis in pancreatic cancer.
25373698 These results suggest that a loss-of-function mutation in the X-linked TBX22 promoter may cause the cleft palate through disruption of TBX22-ETS-1 pathway.
25279986 11q24.3 rs4937362 near ETS1 gene is associated with follicular lymphoma.
25236949 Data show that miR-221 and miR-222 repress respectively the levels of PIK3R1 and ETS1 to regulate angiogenic features in endothelial progenitor cells and endothelial cells.
25210949 inhibition of HMGB1 may protect against hyperglycaemia-induced cardiomyocyte apoptosis by down-regulating ERK-dependent activation of Ets-1.
25135220 beta6 induced phosphorylation of ETS1 via the ERK/MAPK pathways, through which the MMP-3/MMP-9 promoters were stimulated, thereby leading to the up-regulation of MMP-3/MMP-9, and subsequent the invasion of colon cancer cells.
25117710 Phosphorylation of the ETS1 and ETS2 transcriptional oncoproteins at specific serine or threonine residues creates binding sites for the COP1 tumor suppressor protein.
25085587 High expression of miR-124 is associated with lymph node metastases in breast cancer.
25083921 Crystal structure of the Ets1-Runx1-CBFbeta-DNA complex was solved. Runx1 allosterically enhances Ets1-DNA binding via the DNA.
25024220 Synergy of aromatic residues and phosphoserines within the intrinsically disordered DNA-binding inhibitory elements of the Ets-1 transcription factor.
24963049 These data support epigenetic modulation with HCI2509 as a therapeutic strategy for Ewing sarcoma, and highlight a critical dual role for LSD1 in the oncogenic transcriptional activity of EWS/ETS proteins
24952944 DNA complex may be relevant to an emerging role of PU.1, but not Ets-1, as a pioneer transcription factor in vivo
24857950 a potential regulatory role of FBI-1 in transcription factor activity of ETS-1
24844121 These results indicate that allo-antigen stimulated CD8+ T-cells suppress the transcriptional activity of NF-kappaB p65 or Ets-1 in an antigen-nonspecific manner, and inhibit the nuclear transport of phosphorylated NF-kappaB p65.
24816403 Ets-1 has a role in fibronectin-derived heparin-binding domain polypeptides alleviating melanoma cell invasiveness and chemoresistance
24782214 Data show that downregulation of the long interspersed nucleotide acid element-1 (LINE-1) open reading frame-1 protein (ORF-1p) level by small interfering RNA (siRNA) reduced the transcriptional activation of transcription factor ETS-1.
24726443 This study showed that the two compounds, polyP and isoquercitrin, have a co-enhancing effect on bone mineral formation and in turn might be of potential therapeutic value for prevention/treatment of osteoporosis.
24708692 Common variants in ETS1 may contribute to ankylosing spondylitis susceptibility in Han Chinese people
24697319 The gene interactions of the rs1128334 SNP with SNPS in IRF5, STAT4 and IKZF1 in Han Chinese SLE patients were defined. The A allele is a risk factor.
24658012 This study shows that miR-146a and Ets-1 are both associated with pediatric uveitis in Han Chinese.
24646888 Ets1 is activated by Runx1 in human cells
24645837 Co-expression of ETS-1 either with MMP-2 or MMP-9 is associated with high grade breast cancer.
24576667 both HIF2alpha and ETS1 are involved in the transcriptional regulation of Flvcr1a and that HIF2alpha is absolutely required for Flvcr1a induction upon hypoxia
24549174 ETS1 rs1128334 G/A polymorphisms were not associated with the risk of rheumatoid arthritis.
24448423 Findings imply that the genetic (BRCA1 mutation) and epigenetic mechanisms (such as hypomethylated ETS1 motif, and histone modification H3K9ac and ETS1 binding) are jointly involved in the malignant progression of PARP1-related ovarian cancer
24238102 Ets-1 mediates enhanced Sx(c)- activity to increase glutathione levels under oxidative stress.
24221578 These indicated that Ets-1 may play an important role in the stable expression of FOXP3 in CD4(+)CD25(+) Treg cells in patients with systemic lupus erythematosus.
24211252 KG1a cells demonstrated high expression levels of CD7 and ETS-1 allowing a constitutative signaling through the PI3K/Atk pathway to promote GM-CSF expression, while KG1 cells with low expression of CD7 and ETS-1 showed low GM-CSF expression
24203999 Mediator of neointima formation in arteriovenous fistula
24064218 a novel signaling axis, i.e., ROCK-JNK-ETS-1-CD44 pathway, which plays an essential role in the S1P3-regulated chemotactic response.
24019486 Ets-1 promotes the expression of IL-2 by modulating the activity of NFAT.
24012497 Study showed that LINE-1 ORF-1p enhanced ETS-1 transcriptional activity and increased expression of downstream genes of ETS-1. Interaction between ETS-1 and LINE-1 ORF-1p was identified by immunoprecipitation assays.
23948889 This work provides novel findings on expression of the angiogenic transcription factor, Ets-1, in vascular remodeling and its association with pro-angiogenic factors, reactive microglia, and Abeta deposition in AD brain.
23926301 these data identify the 11q24.3 gain as a recurrent lesion in diffuse large B-cell lymphoma leading to ETS1 and FLI1 deregulated expression, which can contribute to the pathogenesis of this disease
23926020 rs1128334 and rs4937333 of ETS1 are strongly associated with the risk for SLE in northern Chinese Han population.
23924923 The levels of Ets-1 were upregulated in cells treated with HGF in a dose-dependent manner. HGF-induced upregulation of IL-8 was repressed by Ets-1 knockdown.
23874775 Transcription factor Ets1 cooperates with estrogen receptor alpha to stimulate estradiol-dependent growth in breast cancer cells and tumors.
23762867 Abnormal hypomethylation of CpG sites within the ETS motif in the core promoter region may be responsible for PARP1 overexpression in endometrial adenocarcinoma tissues.
23737550 During prolonged TGF-beta treatment, p300 acetylated histone and Ets-1, resulting in complete dissociation of Ets-1 and the opening of the chromatin for sustained miR-192 expression
23614478 Epistatic interaction between genetic variants in susceptibility gene ETS1 correlates with IL-17 levels in SLE patients.
23589550 Studies indicate ETS transcription factors, PTEN protein and androgen receptor as tumor markers for diagnosis and therapy of prostate cancer.
23552426 Ets-1 is a novel regulator of VEGFR3 and is involved in the induction of angiogenic phenotypes by KSHV.
23474984 HBx and HBs of hepatitis B virus could increase expression of Ets-1, which consequently contributed to the upregulation of RhoC.
23405229 High Ets-1 expression is associated with cancer.
23383271 miR-9 suppresses the expression of cyclin D1 and Ets1 via the binding sites in their 3'-UTR, thus inhibiting the proliferation, invasion and metastasis of gastric cancer.
23268366 Transcription factor Ets-1 strongly affects miR-146a promoter activity and directly regulates miR-146a expression.
23236436 gene-gene epistatic interactions revealed between IL21 and ETS1 in systemic lupus erythematosus.
23117818 The binding of Ets1 and Elk1 together to the proximal CIP2A promoter is absolutely required for CIP2A expression in cervical, endometrial and liver carcinoma cell lines
23101665 The present study revealed, for first time, the positive association of a polymorphism in the sequence of the ETS1 transcription factor with rheumatoid arthritis susceptibility.
23094960 These results suggest that Ets-1 is involved in transcriptional activation of the alpha3 integrin gene through its binding to the Ets-consensus sequence at -133 bp
23064684 increased ETS-1 expression was associated with a higher stage, higher Gleason score and shorter time to castration-resistant progression in prostate cancer.
23060436 microRNA miR-199a-5p down-regulation switches on wound angiogenesis by derepressing the v-ets erythroblastosis virus E26 oncogene homolog 1-matrix metalloproteinase-1 pathway
22971289 Ets-1 is a transcriptional mediator of oncogenic nitric oxide signaling in estrogen receptor-negative breast cancer.
22936014 Aberrant hypermethylation and reduced expression of ETS1 is associated with myelodysplastic syndromes.
22914732 ETS1 regulates the expression of ATXN2.
22829018 Ets-1 acts as a negative regulator of COL1 production and EMT in TGFbeta1-stimulated renal cells. Ets-1 has a critical role in TGFbeta1-induced Extracellular matrix and epithelial-mesenchymal transition of renal epithelial cells.
22742857 TNF is able to upregulate LT-beta expression in hepatic cells at the transcriptional level by the binding of NF-kappaB p50/p65 heterodimers and Ets1 to their respective sites in the LT-beta promoter.
22615925 The SAM domain of human TEL2 can inhibit the transcriptional activities of ETS1/2 and TEL1.
22539964 Ets-1 is an essential downstream signaling component for CCN2 induction by TGF-beta1 in osteoblasts, and that specific EBE sites in the CCN2 promoter are required for CCN2 promoter transactivation in osteoblasts.
22521293 ETS1, ERK2 and Mxi2 are important complex partners initiating increased p16(INK4a) and p21w(af1/cip1) activation in renal tumor cells.
22516263 The cortical thymic maturation arrest in T-lineage Acute lymphoblastic leukemias (ALLs) that overexpress TLX1 or TLX3 is due to binding of TLX1/TLX3 to ETS1.
22494801 the partial unfolding of Ets-1 upon DNA binding can be achieved by the removal of just a few specific local contacts
22396784 EBV-encoded LMP1 upregulates Igkappa 3'enhancer activity and Igkappa expression in nasopharyngeal cancer cells by activating the Ets-1 through ERKs signaling
22390030 The expression of MMP-1 and Ets-1 protein in laryngeal carcinoma tissues is obviously higher than that in para-carcinoma and in vocal cord polyps.
22366814 ETS-1, the prototype of the ETS family, is expressed in different cell types and is known to play various roles during both physiological and pathological conditions. [Review]
22355253 SNPs miR-146a/rs2910164, ets-1/rs1128334, and ets-1/rs10893872 were genotyped in 219 Han Chinese patients with Fuchs uveitis syndrome and 612 healthy controls.
22322590 Acid ceramidase, through sphingosine 1-phosphate, promotes an invasive phenotype in prostate cancer by causing overexpression and secretion of cathepsin B through activation and nuclear expression of Ets1.
22307076 we have demonstrated for the first time the novel identification of the ETS-1 splice variants p42 and p27 in PCa cell lines.
22294049 inhibits the interaction of NF-kappaB and CREB, and downregulates IL-1beta-induced MUC5AC overproduction during airway inflammation
22270366 ETS-1 protein regulates vascular endothelial growth factor-induced matrix metalloproteinase-9 and matrix metalloproteinase-13 expression in human ovarian carcinoma
22232738 These data suggest a role for oncogenic ETS1 transcriptional activity in promoting aggressive prostate cancer and the castrate-resistant phenotype.
22206665 ETS1 promotes paclitaxel resistance and invasion in part by up-regulating MDR1 and MMP9 expression.
22096509 Data observed in DMD and aging skeletal muscle enrichment in motifs for candidate transcription factors that may coordinate either the immune/fibrosis responses (ETS1, IRF1, NF1) or the mitochondrial metabolism (ESRRA).
22087647 Data indicate that TNFAIP3, ETS1 and TNIP1 are probably common susceptibility genes for systemic lupus erythematosus (SLE) in Chinese populations, and they may contribute to the pathogenesis of multiple SLE subphenotypes.
22073215 HIV-1 Tat binding peaks in Tat expression Jurkat cells are associated with specific cellular factors (CBP and ETS) and chromatin marks (H3K4me3 and H3K27me3) in Jurkat cells
21940109 ETS-1 expression may play an important role in tumor invasion, and may function in the initiation of the invasive process in laryngeal squamous cell carcinoma.
21925842 Study reveals an important role for cav-1 as a negative regulator of MMP-1 gene expression via inhibition of Erk1/2/Ets1 signaling in dermal fibroblasts.
21919915 ETS1 increased significantly in allergen-challenged CD4(+) cells from patients compared to controls.
21841808 The overexpression of ETS1 could suppress cyclin D3 mRNA and protein levels.
21741415 Role of acetylation along c-SRC/ETS1 signaling pathway in bone metastatic and invasive mammary cell phenotypes.
21737519 Data conclude that members of the C/EBP and Ets families can differentially modulate CS-Benh and CS-Aenh activity.
21732343 In a signaling cascade, the loss of E-cadherin activates the transcriptional regulator ETS-1 and consequently leads to the induction of RhoC expression that stabilizes c-Jun in melanoma.
21711453 The proto-oncogene ETS-1, involved in the pathogenesis of cancers of different origin, is a transcriptional regulator of miR-222 by direct binding to its promoter region.
21623185 decreased ETS-1 expression is significantly associated with high grade and advanced stage in urothelial carcinomas of the urinary bladder
21515670 cyclin E and CDK2 genes are key physiological effectors of the c-ETS1 proto-oncogene. Furthermore, c-ETS1 is indispensable for the hepatotropic action of HBx in cell cycle deregulation.
21445343 results suggest that in addition to its established role in invasion and angiogenesis, ETS1 may support malignant cellular growth via regulation of CIP2A expression and protein phosphatase 2A inhibition
21444677 miR-125b is methylated and functions as a tumor suppressor by regulating the ETS1 proto-oncogene in human invasive breast cancer
21439064 The expression of Ets-1, Ang2 and maspin showed close relationship with angiogenesis in ovarian cancer and expression of maspin appeared to be correlated with high grade and microvessel density.
21424114 evidence for the importance of Ets-1 in the development and progression of prostate cancer
21423203 Mutations in the Ets-1 binding site or knockdown of Ets-1 inhibited the increase in Mcl-1, indicating that Ets-1 has a critical role in transcriptional upregulation of Mcl-1
21377967 The gene fusions TMPRSS2 and E26 are present in over 50% of patients with prostate cancer. [Review]
21081489 hypoxia-sensitive miR-200b is involved in induction of angiogenesis via directly targeting Ets-1 in HMECs.
20938207 Hypoxia facilitates Ets-1 up-regulation in Human aortic smooth muscle cell in addition to driving enhanced secretion of MMP-2 and MMP-9
20842667 ETS1 upregulation of NKX3.1 expression in LNCaP cells is mediated in part via its interaction with an EBS located in the NKX3.1 5' proximal promoter.
20819682 Study found significant difference of expression level ETS1 in systemic lupus erythematosus patients compared to healthy controls among the Chinese Han Populations.
20671229 transcription factors Ets-1 and Ets-2 play a key role in controlling the expression of miR-126 and suggest that miR-126 may mediate some of their vascular effects
20645833 expression of Ets-1 is up-regulated by bFGF; Ets-1 is a regulatory factor in addition to bFGF in regulation of gene expression (up-regulation) of urokinase-type plasminogen activator in invasiveness of ovarian cancer
20516000 Significant associations were found for the single nucleotide polymorphism rs6590330 of ETS1 with systemic lupus erythematosus of age at diagnosis <20 years
20516000 Observational study of gene-disease association. (HuGE Navigator)
20479932 The prostate-specific tumor suppressor gene Nkx3.1 was controlled by ERG and ESE3 both directly and through induction of EZH2.
20435626 decreased expression of Ets-1 protein generalizes to granulocytic differentiation and may represent a crucial event for granulocytic maturation.
20392592 high ETS1 expression levels in all resistant MCF-7 sublines may lead to the upregulation of the transcription of MDR1 gene; overexpression of ETS1 gene in resistant cells may have contributed to the development of resistance in the cells
20378371 The known roles for Ets-1 in regulating the differentiation of immune cells and other cell types, is summarized.
20367922 Transcription factor Ets-1 is expressed in human amniochorionic membranes and it could be up-regulated in premature rupture of fetal membranes.
20169177 Genetic variants in ETS1 and WDFY4 were found to be associated with systemic lupus erythematosus, in the Asian population studied.
20169177 Observational study of gene-disease association. (HuGE Navigator)
20097731 Dual specificity phosphatase 6 (DUSP6) is an ETS-regulated negative feedback mediator of oncogenic ERK signaling in lung cancer cells.
20021863 A higher expression of Ets-1 is involved in carcinogenesis, development, invasion, and metastasis of gastric cancer.
20019798 The distinct sequences associated with redundant versus specific ETS1 occupancy were predictive of promoter or enhancer location and the ontology of nearby genes.
20001963 Ets-1 is processed in a caspase 3-dependent manner.
19942620 Deletion of ETS-1 in chromosome 11 cause Jacobsen syndrome.
19935876 Results show that Ets1 and Stat1 functionally interact to optimize ICAM-1 transcription.
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19836356 a novel interaction partner for Ets-1 isoforms: a heterotrimeric complex of DNA-dependent protein kinase (DNA-PK), made up of Ku70, Ku86, and DNA-PK catalytic subunit (DNA-PKcs) was reported.
19787252 The data presented here underscore the importance of Ets-1 in tumour development and progression
19657377 In this review, ETS gene rearrangement is a key event in driving prostate neoplastic development: the rearrangement occurs as an early event and continues to be expressed in metastatic and castration-resistant disease.
19616560 The authors report that Pax5 assembles the ternary complexes with DNA via highly cooperative interactions that overcome the autoinhibition of Ets-1.
19499154 propose that NGX6 expression is lost in the process of human colorectal carcinogenesis. Its overexpression can inhibit expression of transcription factors AP-1 and Ets-1, and down-regulate transcriptional activity of the cyclin D1 promoter in human CRC
19465391 The results establish that differential DNA bending, via p51 and p42 differential binding, is correlated with the Stromelysin-1 promoter activation process.
19427971 The aim of this study was to investigate the prognostic relevance of LMP-1 and its relationship with MMP-1 and Ets-1 expression in nasopharyngeal carcinoma biopsies.
19336585 DeltaVII-Ets-1 activated HIV-1 transcription through 2 conserved regions in the LTR, and reactivated latent HIV-1 in cells from patients on HAART without causing significant T cell activation
19225563 Downregulation of ETS1 expression by siRNA abrogated the reduction of vasculogenic progenitor cells number induced by high-glucose treatment of diabetic patients
19205872 alphaB-crystallin gene expression is regulated by the transcription factor Ets1 in breast cancer
19154409 Ets-1 can induce aberrant Pim-3 expression and subsequently prevent apoptosis in human pancreatic cancer cells.
19116245 Ets1 was found to transactivate the V2 proximal promoter through specific Ets sites.
19091791 Ets-1 mediates platelet-derived growth factor-BB-induced thrombomodulin expression in human vascular smooth muscle cells.
19022222 Ets-1 binds cooperatively to the EBS palindrome of the hp53 promoter.
18955504 Binding elements for ETS and transcription factor AP-2 (TFAP2) were significantly enriched in Smad2/3 binding sites, and knockdown of either ETS1 or TFAP2A resulted in overall alteration of TGF-beta-induced transcription.
18948081 Ets-1 binds to the human epiregulin promoter and regulates epiregulin expression.
18851945 This study confirms that Ets-1 is a downstream effector of oncogenic HER2, associated with MMP-1.
18720385 Hypoxic regulation of Ang-2 is HIF-dependent and demonstrate that HIF-1alpha binds in human microvascular endothelial cells (HMVEC) to an evolutionary conserved Hypoxia-Responsive Element (HRE) located in the first intron of the Ang-2 gene.
18676374 MUC5AC gene expression are mediated by a complex regulatory cascade controlling interactions between CREB and c-Ets1 that bind to a promoter element in the MUC5AC gene enhancing MUC5AC gene transcription.
18625704 an angiogenic signal-ETS1/HIF-2alpha axis regulates the VEGFR1 chromatin domain to induce VEGFR1 transcription in endothelial cells and in differentiating embryonic stem cells
18566588 Study presents the structure of Ets-1 on the stromelysin-1 promoter element, revealing a ternary complex in which protein homo-dimerization is mediated by the specific arrangement of the two ETS-binding sites.
18538735 Suggest functional role for SPINK1 in ETS rearrangement-negative prostate cancers.
18381358 The downregulation of ETS1 expression with small interfering RNA (siRNA) is involved in regulating hypoxia-inducible genes.
18292499 A proximal Ets-1 site and an upstream potential vitamin D response element are critical for the inducible expression of chemokine (C-C motif) receptor 10 (CCR10) by 1,25-dihydroxyvitamin D3 in terminally differentiating B cells.
18172009 MDMX basal promoter activity requires c-Ets-1 and Elk-1. c-Ets-1 and Elk-1 control MDMX transcription and contribute to the suppression of p53 activity.
17977828 Expression of Ets-1 must be down-regulated before plasmacytic differentiation can occur.
17845581 Transactivation by Ets1 increased luciferase expression 15-fold, in the absence of stimulation. Synergistic interactions were demonstrated between Ets1, GATA-3 and AP-1.
17785952 Ets-1 appears to be a useful predictor of poor prognosis after surgical resection in lung adenocarcinoma patients.
17721441 Binding sequences for the avian erythroblastosis virus E26 homologue (ETS) transcription factor family were also highly enriched, and an interaction between the AR and ETS1 at a subset of AR promoter targets, was uncovered.
17671502 Identification of distinct classes of ETS gene rearrangements demonstrates that dormant oncogenes can be activated in prostate cancer by juxtaposition to tissue-specific or ubiquitously active genomic loci.
17661355 ETS transcription regulatory networks have a role in breast cancer progression [review]
17656364 Ets-1 enhances expression of the beta-1,4-GalT V gene through activation of the Sp1 gene in cancer cells
17456046 PIASy controls Ets-1 function, at least in part, by inhibiting Ets-1 protein turnover via the ubiquitin-proteasome system.
17397260 The results suggest that multiple cellular signaling pathways can reactivate the virus in a genetically homogeneous cell population. Further analysis revealed that the Raf/MEK/ERK/Ets-1 pathway mediates Ras-induced reactivation.
17376198 HIV-1 Tat binding peaks in Tat expression Jurkat cells are associated with specific cellular factors (CBP and ETS) and chromatin marks (H3K4me3 and H3K27me3) in Jurkat cells
17321669 Coexpression of Etsl and CBP induced a synergistic activation of the parathyroid hormone-related protein P3 promoter only in the tumorigenic cell line.
17287278 KSHV activated the Ang-2 promoter via AP-1 and Ets1 transcriptional factors, which were mediated by ERK, JNK, and p38 mitogen-activated protein kinase (MAPK) pathways.
17283532 The expressions of KAI1, nm23, ETS-1 and VEGF proteins were highly related to microvascular density, cervical lymph node metastasis, and prognosis of nasopharyngeal carcinoma.
17213822 the interaction between ETS1 and GFI1 facilitates their binding to specific sites on the Bax promoter and represses Bax expression
17105191 delineation of the details of the molecular recognition of Ets-1 by ERK2, the binding of various mutants and truncations of Ets-1 were analyzed by fluorescence anisotropy
16894529 Results demonstrated higher expression of Ets-1 protein in meningiomas with subsequent recurrences compared with meningiomas from patients who had no recurrences.
16887814 CD226 promoters P1 and P2 are regulated by Ets-1 and AP-1
16829517 Fli1 and Ets1 have roles in the pathological extracellular matrix regulation during fibrosis and cancer
16786167 Results found that basal Ets-1 levels are necessary not only for a fast induction of MMPs but also for maintenance of the bFGF-induced expression of TIMPs.
16722933 Up-regulation of Ets-1 expression was observed in atypical and anaplastic meningiomas.
16684505 Taken together, these results suggest that AP-2epsilon and Ets-1 are involved in the regulation of integrin alpha10 transcription in chondrocytes.
16586544 Ets-1 plays an important role in the growth and differentiation of gastrointestinal stromal tumors, leiomyomas and schwannomas.
16569638 matrix metalloproteinase-1 expression is regulated by JNK through Ets and AP-1 promoter motifs
16455618 Plays a critical role in the induction of human decidualization.
16294212 Overexpression of Ets-1 in human hematopoietic progenitor cells blocks erythroid and promotes megakaryocytic differentiation.
16278291 overexpression of SphK1 up-regulated MMP1 protein, MMP1 mRNA, and MMP1 promoter activity, and this action of SphK1 required activation of the ERK1/2-Ets1 and NF-kappaB pathways
16263717 c-Myb and c-Ets family members (Ets-1/2, PU.1, and Spi-B) control hGR 1A promoter regulation in T- and B-lymphoblast cells
16234432 ets-1 is transcriptionally up-regulated by H2O2 via an antioxidant response element in tumor cell lines
16192649 Peroxide-inducible ETS1 mediates platelet-derived growth factor receptor-alpha gene transcription in vascular smooth muscle cells.
15996661 STAT1 and Nmi are downstream targets of Ets-1 in MCF-7 human breast cancer cells
15940256 Ets-1 expression increases the transformed phenotype of HeLa cells, by promoting cell migration, invasion and anchorage-independent growth, while Ets-1 downregulation reduces cell attachment.
15848191 Modification of local protooncogene Ets-1 level is likely being involved in the regulation of melanoma growth
15699632 Ets1 is activated in human adrenocortical cells expressing a mutated K-ras gene.
15693893 Results suggest that Ets-1 might play an important role in carcinogenesis and/or the progression of human prostatic carcinomas.
15592518 Genes that are negatively regulated by ETS1 and upregulated by SP100 have antimigratory or antiangiogenic properties.
15578430 Associated with tumour growth and histological differentiation of breast carcinomas.
15574387 Ets-1 has a role in breast tumor growth and spread [review]
15572696 Ras/mitogen-activated protein kinase signaling activates ETS-1 by CBPp300 recruitment.
15563472 Interleukins 2 and 15 regulate Ets1 expression via ERK1/2 and MNK1 in human natural killer cells
15531915 Ets1 serves as an effector for protein kinase C alpha to fulfil certain functions in cancer ce
15469934 proximal 5'-flanking region of the IKKalpha gene contains a functional promoter reciprocally regulated by p53 and ETS-1
15389378 Protein kinase C is a potential regulator of Ets1 activity in breast cancer cells.
15302318 ETS-1 in ovarian endometriomas is significantly positively correlated with microvessel counts.
15247905 SP100 modulates ETS1-dependent biological processes
15173033 Ets-1 regulated angiogenesis through the induction of angiogenic growth factors (VEGF and HGF).
15123671 Data suggest that glycogen synthase kinase-3beta-phosphorylated Ets1 is a target of Runx1-recruited calcineurin phosphatase at the granulocyte macrophage colony-stimulating factor promoter.
15001984 a novel, functional binding element in the proximal region of the TN-C promoter mediating responsiveness to TGF-beta involving Smad3/4, Sp1, Ets1, and CBP/p300
14734780 Ets-1 expression is increased in asthma and contributes to enhanced expression of TNF-alpha-induced matrix metalloproteinase-9 and tenascin in bronchial fibroblasts activated ex vivo.
14704859 Ets-1 is involved in transcriptional regulation of factors involved in invasion of melanoma cells.
14586398 p53 inhibits transcriptional activation of invasion gene thromboxane synthase mediated by the proto-oncogenic factor ets-1.
14557674 binding of ETS transcription factors to the ETS binding sites in the human LIF promoter is critical for its inducibility in response to T cell activators and play an important functional role within the endocrine-immune network.
12967474 overexpression of ETS-1 is associated with angiogenesis and ovarian cancer progression
12949792 Upregulation of Ets 1 transcription factor ia assiciated with neoplasm invasiveness in Hereditary nonpolyposis colorectal cancers
12932931 ets-1 together with microvessel density determined by CD105 may have prognostic value in the multistep event of carcinogenesis.
12920221 Ets-1 expression may be an important pathogenic mechanism and predictor of aggressive biologic behavior of cutaneous melanoma
12850290 findings suggest a potential mechanism by which PTHrP transcription may be regulated by Ets-1 as a consequence of events that promote tumorigenic behavior in breast epithelial cells
12843180 AP-2alpha gene expression in the placenta is enhanced by a cis-acting element at nucleotides -1279 to -1139 that contains a critical Ets1-binding site.
12743594 interacts with EAPII and modulates its transcriptional function
12632078 a splicing variant of Ets1 is downregulated in invasive Ets1-expressing breast cancer cells
12632071 ETS1 may be regulated by PKCalpha in invasive breast cancer cells
12475968 ETS1 phosphorylation by CAMKII is regulated in a pathway with calcium and GM-CSF
12466970 Its expression is an independent prognostic marker for relapse-free survival in breast cancer
12464608 HIF-2alpha and Ets-1 binding is required for transcriptional activation of Flk-1 in endothelial cells
12377649 results showed a significant correlation between microvessel count and ets-1 gene expression levels in uterine endometrial cancers; localization of ETS-1 was similar to that of vascular endothelial cells
12377648 results showed a significant correlation between microvessel counts and ets-1 gene expression levels in uterine cervical cancers;localization of ETS-1 was similar to that of vascular endothelial cells
12073053 Coexpression of P-glycoprotein, Ets-1, and p53 in oral carcinoma is associated with poor prognosis
12034715 cooperatively binds to the palindromic head to head ETS-binding sites of the stromelysin-1 promoter by counteracting autoinhibition
11971908 Epidermal growth factor-mediated activation of the ETS domain transcription factor Elk-1 requires nuclear calcium
11909962 Sp100 interacts with ETS-1 and stimulates its transcriptional activity.
11836635 c-Ets1 expression in epithelial ovarian cancer correlates to the malignant potential of the tumor.
11830328 Hepatocyte growth factor induces collagenase (matrix metalloproteinase-1) via the transcription factor Ets-1 in human hepatic stellate cell line.

AA Sequence

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR      1 - 70
QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY     71 - 140
QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL    141 - 210
RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV    211 - 280
PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC    281 - 350
QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS    351 - 420
LLGYTPEELHAMLDVKPDADE                                                     421 - 441
//

Text Mined References (295)

PMID Year Title
26938745 2016 Genome Wide Mapping of NR4A Binding Reveals Cooperativity with ETS Factors to Promote Epigenetic Activation of Distal Enhancers in Acute Myeloid Leukemia Cells.
26743285 2015 Changes in immunoexpression of p53, Ki-67, Ets-1, APAF-1 and PTEN in serrated and conventional colon adenomas.
26389665 2015 Non-canonical NF-?B signalling and ETS1/2 cooperatively drive C250T mutant TERT promoter activation.
26365772 2015 c-ETS transcription factors play an essential role in the licensing of human MCM4 origin of replication.
26296467 2015 Fentanyl inhibits the invasion and migration of colorectal cancer cells via inhibiting the negative regulation of Ets-1 on BANCR.
26241881 2015 Association of E26 Transformation Specific Sequence 1 Variants with Rheumatoid Arthritis in Chinese Han Population.
26195629 2015 A Role for Autoinhibition in Preventing Dimerization of the Transcription Factor ETS1.
26177288 2015 MiR-324-5p Suppresses Hepatocellular Carcinoma Cell Invasion by Counteracting ECM Degradation through Post-Transcriptionally Downregulating ETS1 and SP1.
26150526 2015 EGFR inhibition evokes innate drug resistance in lung cancer cells by preventing Akt activity and thus inactivating Ets-1 function.
26122040 2015 Estrogen receptor ? enhances the transcriptional activity of ETS-1 and promotes the proliferation, migration and invasion of neuroblastoma cell in a ligand dependent manner.
26072332 2015 Expression of the ETS transcription factor GABP? is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
26039128 2015 Impact of V-ets Erythroblastosis Virus E26 Oncogene Homolog 1 Gene Polymorphisms Upon Susceptibility to Autoimmune Diseases: A Meta-Analysis.
25929465 2015 TLR9-induced miR-155 and Ets-1 decrease expression of CD1d on B cells in SLE.
25912876 2015 MicroRNA-129-5p inhibits hepatocellular carcinoma cell metastasis and invasion via targeting ETS1.
25893733 2015 MicroRNA-221/222 regulate ox-LDL-induced endothelial apoptosis via Ets-1/p21 inhibition.
25885538 2015 Comparison of MAPK specificity across the ETS transcription factor family identifies a high-affinity ERK interaction required for ERG function in prostate cells.
25880398 2015 An Rb1-dependent amplification loop between Ets1 and Zeb1 is evident in thymocyte differentiation and invasive lung adenocarcinoma.
25865496 2015 Lupus Risk Variant Increases pSTAT1 Binding and Decreases ETS1 Expression.
25776481 2015 miR-377 functions as a tumor suppressor in human clear cell renal cell carcinoma by targeting ETS1.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25726912 2015 Transcriptional regulation of the apolipoprotein F (ApoF) gene by ETS and C/EBP? in hepatoma cells.
25651508 2015 ETS1 induces human trophoblast differentiation.
25639877 2015 Ets1 identified as a novel molecular target of RNA aptamer selected against metastatic cells for targeted delivery of nano-formulation.
25633318 2015 Tyrosine kinase receptor B protects against coronary artery disease and promotes adult vasculature integrity by regulating Ets1-mediated VE-cadherin expression.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25531327 2015 PAX3 and ETS1 synergistically activate MET expression in melanoma cells.
25421630 2015 Transcriptional silencing of ETS-1 abrogates epithelial-mesenchymal transition resulting in reduced motility of pancreatic cancer cells.
25373698 2015 Loss-of-function mutation in the X-linked TBX22 promoter disrupts an ETS-1 binding site and leads to cleft palate.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25236949 2014 miRNome traits analysis on endothelial lineage cells discloses biomarker potential circulating microRNAs which affect progenitor activities.
25210949 2014 HMGB1 mediates hyperglycaemia-induced cardiomyocyte apoptosis via ERK/Ets-1 signalling pathway.
25135220 2014 ?6 integrin induces the expression of metalloproteinase-3 and metalloproteinase-9 in colon cancer cells via ERK-ETS1 pathway.
25117710 2014 Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor.
25085587 2014 MicroRNA-124 inhibits cellular proliferation and invasion by targeting Ets-1 in breast cancer.
25083921 2015 A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
25024220 2014 Synergy of aromatic residues and phosphoserines within the intrinsically disordered DNA-binding inhibitory elements of the Ets-1 transcription factor.
24963049 2014 Reversible LSD1 inhibition interferes with global EWS/ETS transcriptional activity and impedes Ewing sarcoma tumor growth.
24952944 2014 Mechanistic heterogeneity in site recognition by the structurally homologous DNA-binding domains of the ETS family transcription factors Ets-1 and PU.1.
24857950 2014 FBI-1 enhances ETS-1 signaling activity and promotes proliferation of human colorectal carcinoma cells.
24844121 2014 Allo-antigen stimulated CD8+ T-cells suppress NF-?B and Ets-1 DNA binding activity, and inhibit phosphorylated NF-?B p65 nuclear localization in CD4+ T-cells.
24816403 2014 Role of Ets-1 in fibronectin-derived heparin-binding domain polypeptides alleviating melanoma cell invasiveness and chemoresistance.
24782214 2014 Long interspersed nucleotide acid element-1 ORF-1 protein promotes proliferation and invasion of human colorectal cancer LoVo cells through enhancing ETS-1 activity.
24726443 2014 Isoquercitrin and polyphosphate co-enhance mineralization of human osteoblast-like SaOS-2 cells via separate activation of two RUNX2 cofactors AFT6 and Ets1.
24708692 2014 ETS1 variants confer susceptibility to ankylosing spondylitis in Han Chinese.
24697319 2014 Gene-gene interactions of IRF5, STAT4, IKZF1 and ETS1 in systemic lupus erythematosus.
24658012 2014 MicroRNA-146a and Ets-1 gene polymorphisms are associated with pediatric uveitis.
24646888 2014 Structural basis of Ets1 activation by Runx1.
24645837 2014 Prognostic values of ETS-1, MMP-2 and MMP-9 expression and co-expression in breast cancer patients.
24576667 2014 Hypoxia controls Flvcr1 gene expression in Caco2 cells through HIF2? and ETS1.
24549174 2014 E26 transformation-specific-1 (ETS1) and WDFY family member 4 (WDFY4) polymorphisms in Chinese patients with rheumatoid arthritis.
24448423 2014 Poly (ADP-ribose) polymerase 1 transcriptional regulation: a novel crosstalk between histone modification H3K9ac and ETS1 motif hypomethylation in BRCA1-mutated ovarian cancer.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24238102 2013 Ets-1 regulates intracellular glutathione levels: key target for resistant ovarian cancer.
24221578 2014 Expression of Ets-1 and FOXP3 mRNA in CD4(+)CD25 (+) T regulatory cells from patients with systemic lupus erythematosus.
24211252 2014 Autocrine GM-CSF transcription in the leukemic progenitor cell line KG1a is mediated by the transcription factor ETS1 and is negatively regulated through SECTM1 mediated ligation of CD7.
24203999 2014 The transcription factor E26 transformation-specific sequence-1 mediates neointima formation in arteriovenous fistula.
24064218 2013 ETS-1-mediated transcriptional up-regulation of CD44 is required for sphingosine-1-phosphate receptor subtype 3-stimulated chemotaxis.
24019486 2013 Ets-1 facilitates nuclear entry of NFAT proteins and their recruitment to the IL-2 promoter.
24012497 2013 LINE-1 ORF-1p functions as a novel HGF/ETS-1 signaling pathway co-activator and promotes the growth of MDA-MB-231 cell.
23948889 2013 Upregulation and expression patterns of the angiogenic transcription factor ets-1 in Alzheimer's disease brain.
23926301 2013 Deregulation of ETS1 and FLI1 contributes to the pathogenesis of diffuse large B-cell lymphoma.
23926020 2013 [Association of two SNPs in 3'UTR of ETS1 gene with systemic lupus erythematosus in a northern Chinese Han population].
23924923 2013 Hepatocyte growth factor-mediated gastrin-releasing peptide induces IL-8 expression through Ets-1 in gastric cancer cells.
23874775 2013 Transcription factor Ets1 cooperates with estrogen receptor ? to stimulate estradiol-dependent growth in breast cancer cells and tumors.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23762867 2013 Hypomethylation of ETS transcription factor binding sites and upregulation of PARP1 expression in endometrial cancer.
23737550 2013 Acetylation of Ets-1 is the key to chromatin remodeling for miR-192 expression.
23614478 2013 Epistatic interaction between genetic variants in susceptibility gene ETS1 correlates with IL-17 levels in SLE patients.
23589550 2013 Advancing precision medicine for prostate cancer through genomics.
23552426 2013 Ets-1 is required for the activation of VEGFR3 during latent Kaposi's sarcoma-associated herpesvirus infection of endothelial cells.
23474984 2013 HBx and HBs regulate RhoC expression by upregulating transcription factor Ets-1.
23405229 2013 The level of Ets-1 protein is regulated by poly(ADP-ribose) polymerase-1 (PARP-1) in cancer cells to prevent DNA damage.
23383271 2013 microRNA-9 suppresses the proliferation, invasion and metastasis of gastric cancer cells through targeting cyclin D1 and Ets1.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23268366 2014 MicroRNA-146a and Ets-1 gene polymorphisms in ocular Behcet's disease and Vogt-Koyanagi-Harada syndrome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23236436 2012 Gene-gene and gene-sex epistatic interactions of MiR146a, IRF5, IKZF1, ETS1 and IL21 in systemic lupus erythematosus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117818 Ets1 and Elk1 transcription factors regulate cancerous inhibitor of protein phosphatase 2A expression in cervical and endometrial carcinoma cells.
23101665 2013 Altered sequence of the ETS1 transcription factor may predispose to rheumatoid arthritis susceptibility.
23094960 2012 Involvement of transcription factor Ets-1 in the expression of the ?3 integrin subunit gene.
23064684 2012 Overexpression of ETS-1 is associated with malignant biological features of prostate cancer.
23060436 2012 The microRNA miR-199a-5p down-regulation switches on wound angiogenesis by derepressing the v-ets erythroblastosis virus E26 oncogene homolog 1-matrix metalloproteinase-1 pathway.
22971289 2012 Ets-1 is a transcriptional mediator of oncogenic nitric oxide signaling in estrogen receptor-negative breast cancer.
22936014 2013 Genome-wide profiling of methylation identifies novel targets with aberrant hypermethylation and reduced expression in low-risk myelodysplastic syndromes.
22914732 2012 ETS1 regulates the expression of ATXN2.
22829018 2012 Inhibitory effects of the transcription factor Ets-1 on the expression of type I collagen in TGF-?1-stimulated renal epithelial cells.
22742857 2012 TNF-inducible expression of lymphotoxin-? in hepatic cells: an essential role for NF-?B and Ets1 transcription factors.
22615925 2012 The SAM domain of human TEL2 can abrogate transcriptional output from TEL1 (ETV-6) and ETS1/ETS2.
22539964 2012 Ets-1 is essential for connective tissue growth factor (CTGF/CCN2) induction by TGF-?1 in osteoblasts.
22521293 2012 ETS-dependent p16INK4a and p21waf1/cip1 gene expression upon endothelin-1 stimulation in malignant versus and non-malignant proximal tubule cells.
22516263 2012 TLX homeodomain oncogenes mediate T cell maturation arrest in T-ALL via interaction with ETS1 and suppression of TCR? gene expression.
22494801 2012 Importance of local interactions for the stability of inhibitory helix 1 in apo Ets-1.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22396784 2012 EBV-encoded LMP1 upregulates Ig? 3'enhancer activity and Ig? expression in nasopharyngeal cancer cells by activating the Ets-1 through ERKs signaling.
22390030 2011 [Expression of matrix metalloproteinase-1, E26 transformation-specific-1 in laryngeal carcinoma tissue and the clinical significance].
22366814 2012 ETS transcription factors and prostate cancer: the role of the family prototype ETS-1 (review).
22355253 2012 Lack of association of miR-146a and Ets-1 gene polymorphisms with Fuchs uveitis syndrome in Chinese Han patients.
22322590 2012 Acid ceramidase-mediated production of sphingosine 1-phosphate promotes prostate cancer invasion through upregulation of cathepsin B.
22307076 2012 Novel identification of the ETS-1 splice variants p42 and p27 in prostate cancer cell lines.
22294049 2012 c-Ets1 inhibits the interaction of NF-?B and CREB, and downregulates IL-1?-induced MUC5AC overproduction during airway inflammation.
22270366 2012 ETS-1 protein regulates vascular endothelial growth factor-induced matrix metalloproteinase-9 and matrix metalloproteinase-13 expression in human ovarian carcinoma cell line SKOV-3.
22232738 2012 ETS1 transcriptional activity is increased in advanced prostate cancer and promotes the castrate-resistant phenotype.
22206665 2012 ETS1 promotes chemoresistance and invasion of paclitaxel-resistant, hormone-refractory PC3 prostate cancer cells by up-regulating MDR1 and MMP9 expression.
22096509 2011 Immune response and mitochondrial metabolism are commonly deregulated in DMD and aging skeletal muscle.
22087647 2011 Replicated associations of TNFAIP3, TNIP1 and ETS1 with systemic lupus erythematosus in a southwestern Chinese population.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21940109 2011 ETS-1 proto-oncogene as a key newcomer molecule to predict invasiveness in laryngeal carcinoma.
21925842 2011 Caveolin-1 is a negative regulator of MMP-1 gene expression in human dermal fibroblasts via inhibition of Erk1/2/Ets1 signaling pathway.
21919915 2012 Increased expression of IRF4 and ETS1 in CD4+ cells from patients with intermittent allergic rhinitis.
21841808 2011 Negative regulation of cyclin D3 expression by transcription factor c-Ets1 in umbilical cord hematopoietic cells.
21741415 2011 Comparative role of acetylation along c-SRC/ETS1 signaling pathway in bone metastatic and invasive mammary cell phenotypes.
21737519 2011 Identification of functional CCAAT/enhancer-binding protein and Ets protein binding sites in the human chorionic somatomammotropin enhancer sequences.
21732343 2012 ETS-1/RhoC signaling regulates the transcription factor c-Jun in melanoma.
21711453 2011 Constitutive activation of the ETS-1-miR-222 circuitry in metastatic melanoma.
21623185 2012 Immunohistochemical determination of ETS-1 oncoprotein expression in urothelial carcinomas of the urinary bladder.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21515670 2011 c-ETS1 facilitates G1/S-phase transition by up-regulating cyclin E and CDK2 genes and cooperates with hepatitis B virus X protein for their deregulation.
21445343 2011 ETS1 mediates MEK1/2-dependent overexpression of cancerous inhibitor of protein phosphatase 2A (CIP2A) in human cancer cells.
21444677 2011 miR-125b is methylated and functions as a tumor suppressor by regulating the ETS1 proto-oncogene in human invasive breast cancer.
21439064 2011 Expression of Ets-1, Ang-2 and maspin in ovarian cancer and their role in tumor angiogenesis.
21424114 2011 Comprehensive gene expression microarray analysis of Ets-1 blockade in PC3 prostate cancer cells and correlations with prostate cancer tissues: Insights into genes involved in the metastatic cascade.
21423203 2011 Ets-1 mediates upregulation of Mcl-1 downstream of XBP-1 in human melanoma cells upon ER stress.
21377967 2011 [The progress of TMPRSS2-ETS gene fusions and their mechanism in prostate cancer].
21310411 2011 Endothelial enriched microRNAs regulate angiotensin II-induced endothelial inflammation and migration.
21179004 2011 Differential genomic targeting of the transcription factor TAL1 in alternate haematopoietic lineages.
21081489 2011 miR-200b targets Ets-1 and is down-regulated by hypoxia to induce angiogenic response of endothelial cells.
20938207 2011 Hypoxia in abdominal aortic aneurysm supports a role for HIF-1? and Ets-1 as drivers of matrix metalloproteinase upregulation in human aortic smooth muscle cells.
20842667 2011 ETS1 regulates NKX3.1 5' promoter activity and expression in prostate cancer cells.
20819682 2010 Expression analysis of ETS1 gene in peripheral blood mononuclear cells with systemic lupus erythematosus by real-time reverse transcription PCR.
20671229 2010 Ets-1 and Ets-2 regulate the expression of microRNA-126 in endothelial cells.
20645833 2010 Effect of bFGF on invasion of ovarian cancer cells through the regulation of Ets-1 and urokinase-type plasminogen activator.
20516000 2010 TNIP1, SLC15A4, ETS1, RasGRP3 and IKZF1 are associated with clinical features of systemic lupus erythematosus in a Chinese Han population.
20479932 2010 ETS transcription factors control transcription of EZH2 and epigenetic silencing of the tumor suppressor gene Nkx3.1 in prostate cancer.
20435626 2010 Transcriptional silencing of the ETS1 oncogene contributes to human granulocytic differentiation.
20392592 2010 Drug resistant breast cancer cells overexpress ETS1 gene.
20378371 2010 Transcription factor Ets-1 in cytokine and chemokine gene regulation.
20367922 2010 [Transcription factor Ets-1 expression in human fetal membranes and its clinical significance].
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20169177 2010 Genome-wide association study in Asian populations identifies variants in ETS1 and WDFY4 associated with systemic lupus erythematosus.
20097731 2010 Dual specificity phosphatase 6 (DUSP6) is an ETS-regulated negative feedback mediator of oncogenic ERK signaling in lung cancer cells.
20021863 2009 [Relationship between Ets-1 expression and angiogenesis, clinicopathological features and survival of patients with gastric carcinoma].
20019798 2009 DNA specificity determinants associate with distinct transcription factor functions.
20001963 2010 Caspase cleavage of Ets-1 p51 generates fragments with transcriptional dominant-negative function.
19942620 2010 Deletion of ETS-1, a gene in the Jacobsen syndrome critical region, causes ventricular septal defects and abnormal ventricular morphology in mice.
19935876 2009 Functional cooperation between Stat-1 and ets-1 to optimize icam-1 gene transcription.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19836356 2009 DNA-dependent protein kinase is a novel interaction partner for Ets-1 isoforms.
19787252 2009 Regulation of protein tyrosine kinases in tumour cells by the transcription factor Ets-1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19657377 2009 ETS gene fusions in prostate cancer.
19616560 2009 Highly cooperative recruitment of Ets-1 and release of autoinhibition by Pax5.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19499154 2009 NGX6 inhibits AP-1 and Ets-1 expression and down-regulates cyclin D1 in human colorectal cancer.
19465391 2009 Ets-1 p51 and p42 isoforms differentially modulate Stromelysin-1 promoter according to induced DNA bend orientation.
19427971 2009 Expression and clinical significance of latent membrane protein-1, matrix metalloproteinase-1 and Ets-1 transcription factor in tunisian nasopharyngeal carcinoma patients.
19377509 2009 Ets-1 p27: a novel Ets-1 isoform with dominant-negative effects on the transcriptional properties and the subcellular localization of Ets-1 p51.
19336585 2009 Isolation of a cellular factor that can reactivate latent HIV-1 without T cell activation.
19225563 2009 Downregulation of ETS rescues diabetes-induced reduction of endothelial progenitor cells.
19205872 2010 Regulation of alphaB-crystallin gene expression by the transcription factor Ets1 in breast cancer.
19154409 2009 Essential contribution of Ets-1 to constitutive Pim-3 expression in human pancreatic cancer cells.
19116245 2009 Transcriptional regulation of the human growth hormone receptor (hGHR) gene V2 promoter by transcriptional activators and repressor.
19091791 2009 Ets-1 mediates platelet-derived growth factor-BB-induced thrombomodulin expression in human vascular smooth muscle cells.
19022222 2009 Ets-1 binds cooperatively to the palindromic Ets-binding sites in the p53 promoter.
18955504 2009 Chromatin immunoprecipitation on microarray analysis of Smad2/3 binding sites reveals roles of ETS1 and TFAP2A in transforming growth factor beta signaling.
18948081 2008 Epiregulin expression by Ets-1 and ERK signaling pathway in Ki-ras-transformed cells.
18851945 2008 Ets-1 upregulates HER2-induced MMP-1 expression in breast cancer cells.
18720385 2008 The angiopoietin-2 gene of endothelial cells is up-regulated in hypoxia by a HIF binding site located in its first intron and by the central factors GATA-2 and Ets-1.
18692240 2009 Physical and functional interactions between hematopoietic cell-specific ETS transcription factors and homeodomain proteins.
18676374 2008 cAMP-responding element-binding protein and c-Ets1 interact in the regulation of ATP-dependent MUC5AC gene expression.
18625704 2008 Activation of the VEGFR1 chromatin domain: an angiogenic signal-ETS1/HIF-2alpha regulatory axis.
18566588 2008 Regulation of the transcription factor Ets-1 by DNA-mediated homo-dimerization.
18538735 2008 The role of SPINK1 in ETS rearrangement-negative prostate cancers.
18381358 2008 Regulation of hypoxia-inducible genes by ETS1 transcription factor.
18292499 2008 1,25-dihydroxyvitamin D3 induces CCR10 expression in terminally differentiating human B cells.
18172009 2008 Regulation of MDMX expression by mitogenic signaling.
18020712 2007 The ets-related transcription factor GABP directs bidirectional transcription.
17986575 2007 Transcriptional regulation of telomerase activity: roles of the the Ets transcription factor family.
17977828 2008 Ets-1 regulates plasma cell differentiation by interfering with the activity of the transcription factor Blimp-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17845581 2007 Eosinophilic inflammation: mechanisms regulating IL-5 transcription in human T lymphocytes.
17785952 2007 Ets-1 proto-oncogene as a potential predictor for poor prognosis of lung adenocarcinoma.
17721441 2007 New androgen receptor genomic targets show an interaction with the ETS1 transcription factor.
17671502 2007 Distinct classes of chromosomal rearrangements create oncogenic ETS gene fusions in prostate cancer.
17661355 2007 Defining ETS transcription regulatory networks and their contribution to breast cancer progression.
17656364 2007 Sequential action of Ets-1 and Sp1 in the activation of the human beta-1,4-galactosyltransferase V gene involved in abnormal glycosylation characteristic of cancer cells.
17456046 2007 PIASy controls ubiquitination-dependent proteasomal degradation of Ets-1.
17397260 2007 Systematic identification of cellular signals reactivating Kaposi sarcoma-associated herpesvirus.
17321669 2007 PTHrP P3 promoter activity in breast cancer cell lines: role of Ets1 and CBP (CREB binding protein).
17287278 2007 Kaposi's sarcoma-associated herpesvirus promotes angiogenesis by inducing angiopoietin-2 expression via AP-1 and Ets1.
17283532 2006 [Relationship between the expressions of KaI1, nm23, ETS-1, VEGF and microvascular density and clinical significance in nasopharyngeal carcinoma].
17213822 2007 Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression.
17105191 2006 Properties and regulation of a transiently assembled ERK2.Ets-1 signaling complex.
16894529 2006 Increased expression of avian erythroblastosis virus E26 oncogene homolog 1 in World Health Organization grade 1 meningiomas is associated with an elevated risk of recurrence and is correlated with the expression of its target genes matrix metalloproteinase-2 and MMP-9.
16887814 2006 Identification and characterization of the CD226 gene promoter.
16829517 2006 Fli1 and Ets1 have distinct roles in connective tissue growth factor/CCN2 gene regulation and induction of the profibrotic gene program.
16786167 2006 Expression pattern of matrix metalloproteinase and TIMP genes in fibroblasts derived from Ets-1 knock-out mice compared to wild-type mouse fibroblasts.
16722933 2006 Ets-1 is up-regulated together with its target gene products matrix metalloproteinase-2 and matrix metalloproteinase-9 in atypical and anaplastic meningiomas.
16684505 2006 Regulation of integrin alpha10 expression in chondrocytes by the transcription factors AP-2epsilon and Ets-1.
16586544 2006 Expression of Ets-1 proto-oncoprotein in gastrointestinal stromal tumors, leiomyomas and schwannomas.
16569638 2006 Redox-dependent matrix metalloproteinase-1 expression is regulated by JNK through Ets and AP-1 promoter motifs.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16455618 2006 Transcription factor ETS1 is critical for human uterine decidualization.
16294212 2006 Overexpression of Ets-1 in human hematopoietic progenitor cells blocks erythroid and promotes megakaryocytic differentiation.
16278291 2006 Dihydrosphingosine 1-phosphate stimulates MMP1 gene expression via activation of ERK1/2-Ets1 pathway in human fibroblasts.
16263717 2005 c-Myb and members of the c-Ets family of transcription factors act as molecular switches to mediate opposite steroid regulation of the human glucocorticoid receptor 1A promoter.
16234432 2005 ets-1 is transcriptionally up-regulated by H2O2 via an antioxidant response element.
16192649 2005 Peroxide-inducible Ets-1 mediates platelet-derived growth factor receptor-alpha gene transcription in vascular smooth muscle cells.
16045329 2005 Proximity-induced catalysis by the protein kinase ERK2.
15996661 2005 STAT1 and Nmi are downstream targets of Ets-1 transcription factor in MCF-7 human breast cancer cell.
15940256 2005 Ets-1 expression promotes epithelial cell transformation by inducing migration, invasion and anchorage-independent growth.
15848191 2005 Histamine elevates the expression of Ets-1, a protooncogen in human melanoma cell lines through H2 receptor.
15788656 2005 Associations and interactions between Ets-1 and Ets-2 and coregulatory proteins, SRC-1, AIB1, and NCoR in breast cancer.
15699632 2005 Ets1 was significantly activated by ERK1/2 in mutant K-ras stably transfected human adrenocortical cells.
15693893 2005 Overexpression of Ets-1 proto-oncogene in latent and clinical prostatic carcinomas.
15592518 2005 SP100 inhibits ETS1 activity in primary endothelial cells.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15578430 2005 Expression of the ets-1 proto-oncogene in human breast carcinoma: differential expression with histological grading and growth pattern.
15574387 2005 The transcription factor Ets-1 in breast cancer.
15572696 2004 Ras/mitogen-activated protein kinase signaling activates Ets-1 and Ets-2 by CBP/p300 recruitment.
15563472 2005 Interleukins 2 and 15 regulate Ets1 expression via ERK1/2 and MNK1 in human natural killer cells.
15531915 2005 Ets1 is an effector of protein kinase Calpha in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469934 2004 Identification and characterization of the IKKalpha promoter: positive and negative regulation by ETS-1 and p53, respectively.
15389378 2004 Importance of ets1 proto-oncogene for breast cancer progression.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302318 2004 Expression of E26 transformation specific (ETS-1) related to angiogenesis in ovarian endometriosis.
15247905 2004 SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion.
15199062 2004 STAT6 and Ets-1 form a stable complex that modulates Socs-1 expression by interleukin-4 in keratinocytes.
15173033 2004 In vivo evidence of angiogenesis induced by transcription factor Ets-1: Ets-1 is located upstream of angiogenesis cascade.
15123671 2004 AML1/Runx1 recruits calcineurin to regulate granulocyte macrophage colony-stimulating factor by Ets1 activation.
15001984 2004 Tenascin-C upregulation by transforming growth factor-beta in human dermal fibroblasts involves Smad3, Sp1, and Ets1.
14734780 2004 Ets-1 regulates TNF-alpha-induced matrix metalloproteinase-9 and tenascin expression in primary bronchial fibroblasts.
14704859 2004 The Ets-1 transcription factor is involved in the development and invasion of malignant melanoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14586398 2003 Tumor suppressor p53 inhibits transcriptional activation of invasion gene thromboxane synthase mediated by the proto-oncogenic factor ets-1.
14557674 2004 Regulation of the human leukemia inhibitory factor gene by ETS transcription factors.
12967474 2003 Clinical implications of expression of ETS-1 in relation to angiogenesis in ovarian cancers.
12949792 2003 Stromal expression of invasion-promoting, matrix-degrading proteases MMP-1 and -9 and the Ets 1 transcription factor in HNPCC carcinomas and sporadic colorectal cancers.
12932931 2003 Angiogenetic protooncogene ets-1 induced neovascularization is involved in the metastatic process of testicular germ cell tumors.
12920221 2003 Expression of the ets-1 proto-oncogene in melanocytic lesions.
12850290 2003 Ets-1 activates parathyroid hormone-related protein gene expression in tumorigenic breast epithelial cells.
12843180 2003 Identification of an enhancer of the human activating protein-2alpha gene that contains a critical Ets1 binding site.
12743594 2003 EAPII interacts with ETS1 and modulates its transcriptional function.
12632078 2003 Splicing variant DeltaVII-Ets1 is downregulated in invasive Ets1-expressing breast cancer cells.
12632071 2003 Protein kinase Calpha regulates Ets1 transcriptional activity in invasive breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475968 2002 Calcium regulation of GM-CSF by calmodulin-dependent kinase II phosphorylation of Ets1.
12466970 2002 Expression of the transcription factor Ets-1 is an independent prognostic marker for relapse-free survival in breast cancer.
12464608 2003 Cooperative interaction of hypoxia-inducible factor-2alpha (HIF-2alpha ) and Ets-1 in the transcriptional activation of vascular endothelial growth factor receptor-2 (Flk-1).
12377649 2002 Clinical implications of expression of ETS-1 related to angiogenesis in uterine endometrial cancers.
12377648 2002 Clinical implications of expression of ETS-1 related to angiogenesis in uterine cervical cancers.
12221090 2002 Structural analysis of the autoinhibition of Ets-1 and its role in protein partnerships.
12073053 2002 Coexpression of Ets-1 and p53 in oral carcinomas is associated with P-glycoprotein expression and poor prognosis.
12048211 2002 Role of MAP kinases in the 1,25-dihydroxyvitamin D3-induced transactivation of the rat cytochrome P450C24 (CYP24) promoter. Specific functions for ERK1/ERK2 and ERK5.
12034715 2002 ETS-1 transcription factor binds cooperatively to the palindromic head to head ETS-binding sites of the stromelysin-1 promoter by counteracting autoinhibition.
11971908 2002 Epidermal growth factor-mediated activation of the ETS domain transcription factor Elk-1 requires nuclear calcium.
11948414 2002 Hepatocyte growth factor/scatter factor activates the ETS1 transcription factor by a RAS-RAF-MEK-ERK signaling pathway.
11909962 2002 Sp100 interacts with ETS-1 and stimulates its transcriptional activity.
11590145 2001 Transforming growth factor beta regulates parathyroid hormone-related protein expression in MDA-MB-231 breast cancer cells through a novel Smad/Ets synergism.
11279115 2001 Physical interaction and functional synergy between glucocorticoid receptor and Ets2 proteins for transcription activation of the rat cytochrome P-450c27 promoter.
10942770 2000 Regulation of transcription of the human presenilin-1 gene by ets transcription factors and the p53 protooncogene.
10918595 2000 Hepatitis B virus-X protein upregulates the expression of p21waf1/cip1 and prolongs G1-->S transition via a p53-independent pathway in human hepatoma cells.
10815800 2000 IL-2 and long-term T cell activation induce physical and functional interaction between STAT5 and ETS transcription factors in human T cells.
10698492 2000 EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes.
10377039 1999 Transcription factors Ets1, Ets2, and Elf1 exhibit differential localization in human endometrium across the menstrual cycle and alternate isoforms in cultured endometrial cells.
10212281 1999 Regulation of the human interleukin-5 promoter by Ets transcription factors. Ets1 and Ets2, but not Elf-1, cooperate with GATA3 and HTLV-I Tax1.
10022910 1999 The highly conserved beta-hairpin of the paired DNA-binding domain is required for assembly of Pax-Ets ternary complexes.
9794229 1998 Transcriptional regulation of osteopontin gene in vivo by PEBP2alphaA/CBFA1 and ETS1 in the skeletal tissues.
9566892 1998 c-Maf interacts with c-Myb to regulate transcription of an early myeloid gene during differentiation.
9528793 1998 A role for CREB binding protein and p300 transcriptional coactivators in Ets-1 transactivation functions.
9501572 [Experimental models of angiogenesis for the study of the Ets1 transcription factor].
9334186 1997 The Ets transcription factors interact with each other and with the c-Fos/c-Jun complex via distinct protein domains in a DNA-dependent and -independent manner.
9333025 1997 Modulation of ETS-1 transcriptional activity by huUBC9, a ubiquitin-conjugating enzyme.
9266972 1997 A variant form of ETS1 induces apoptosis in human colon cancer cells.
9094628 1997 Physical interactions between Ets and NF-kappaB/NFAT proteins play an important role in their cooperative activation of the human immunodeficiency virus enhancer in T cells.
9032233 1997 Interaction of Ets-1 and the POU-homeodomain protein GHF-1/Pit-1 reconstitutes pituitary-specific gene expression.
8620536 1996 MafB is an interaction partner and repressor of Ets-1 that inhibits erythroid differentiation.
8557686 1996 Synergistic transcriptional activation of the tissue inhibitor of metalloproteinases-1 promoter via functional interaction of AP-1 and Ets-1 transcription factors.
8521493 1995 The solution structure of the human ETS1-DNA complex reveals a novel mode of binding and true side chain intercalation.
8231246 1993 Quantitative and qualitative variation of ETS-1 transcripts in hematologic malignancies.
7753825 1995 ETS1 suppresses tumorigenicity of human colon cancer cells.
7678559 1993 Mis-splicing yields circular RNA molecules.
3285299 1988 Characterization and localization of the products of the human homologs of the v-ets oncogene.
3060801 1988 Structure, expression and alternative splicing of the human c-ets-1 proto-oncogene.
2997781 1985 The ets sequence from the transforming gene of avian erythroblastosis virus, E26, has unique domains on human chromosomes 11 and 21: both loci are transcriptionally active.
2847145 1988 Mammalian ets-1 and ets-2 genes encode highly conserved proteins.
2612216 1989 Precise in situ localization of NCAM, ETS1, and D11S29 on human meiotic chromosomes.
2187191 1990 Reciprocal expression of human ETS1 and ETS2 genes during T-cell activation: regulatory role for the protooncogene ETS1.
1614856 1992 Serum, AP-1 and Ets-1 stimulate the human ets-1 promoter.
1592264 1992 Interaction of murine ets-1 with GGA-binding sites establishes the ETS domain as a new DNA-binding motif.
1522903 1992 Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours.
1339341 1992 Splicing with inverted order of exons occurs proximal to large introns.