Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.93
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -1.114 7.2e-03
adrenocortical carcinoma 1.272 2.7e-02
pancreatic ductal adenocarcinoma liver m... -2.264 1.3e-03
lung carcinoma 1.300 7.4e-24
Breast cancer 1.100 6.5e-05
invasive ductal carcinoma 1.400 5.0e-03
pituitary cancer 1.700 8.1e-04
psoriasis -1.700 1.9e-98

Protein-protein Interaction (5)

Gene RIF (2)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
18953568 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRL      1 - 70
IQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCA     71 - 140
PKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNE    141 - 210
INPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFD    211 - 280
IGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALI    281 - 350
QNQYSTIDFDFLRYAVIRFNQYFKVKPQASALEMPK                                      351 - 386
//

Text Mined References (13)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
21177773 2011 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
18953568 2008 Male-female differences in the genetic regulation of t-PA and PAI-1 levels in a Ghanaian population.
16861741 2006 Placental thrombosis and spontaneous fetal death in mice deficient in ethanolamine kinase 2.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15161093 2004 Eki2 is upregulated specifically in the testis during mouse sex determination.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11044454 2001 Overexpression of a mammalian ethanolamine-specific kinase accelerates the CDP-ethanolamine pathway.