Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric carcinoma -1.300 3.7e-02
hereditary spastic paraplegia -1.175 1.3e-02
medulloblastoma, large-cell -1.100 2.3e-03
non-small cell lung cancer -1.036 4.5e-15
ovarian cancer 2.300 2.9e-05
pancreatic ductal adenocarcinoma liver m... -1.823 7.1e-04
sonic hedgehog group medulloblastoma -1.300 6.7e-04

Gene RIF (1)

AA Sequence

MKMANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALY      1 - 70
FLRKYRAMKQRYYSDTNKTN                                                       71 - 90
//

Text Mined References (7)

PMID Year Title