Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.30
PubTator Score 14.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 2.4e-06
psoriasis 6514 3.8e-05
osteosarcoma 7766 4.9e-04
diabetes mellitus 1683 1.3e-03
invasive ductal carcinoma 2867 6.9e-03
astrocytoma 1113 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.400 1.2e-02
diabetes mellitus -1.300 1.3e-03
invasive ductal carcinoma -1.300 6.9e-03
osteosarcoma -1.545 4.9e-04
ovarian cancer -1.300 2.4e-06
psoriasis -1.900 3.8e-05

Gene RIF (4)

AA Sequence

MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYL      1 - 70
AGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAE     71 - 140
WLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLD    141 - 210
LNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLIGDLPFVGAVSMFFIRRPTLDINWTGMTNL    211 - 280
LDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKG    281 - 350
LIEGKSDPYALVRLGTQTFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDV    351 - 420
GKVLQASVLDDWFPLQGGQGQVHLRLEWLSLLSDAEKLEQVLQWNWGVSSRPDPPSAAILVVYLDRAQDL    421 - 490
PLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFRFFLQDPQSQELDVQVKDDSRALTLGALTLP    491 - 560
LARLLTAPELILDQWFQLSSSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDA    561 - 630
PPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKLAGRSFRSHVVREDLNPRW    631 - 700
NEVFEVIVTSVPGQELEVEVFDKDLDKDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTP    701 - 770
RPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQT    771 - 840
SAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLDRWFTLSSGQGQVLLRAQL    841 - 910
GILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSAPELRQRLTHVDSPLEAPAGPLGQVKLTLW    911 - 980
YYSEERKLVSIVHGCRSLRQNGRDPPDPYVSLLLLPDKNRGTKRRTSQKKRTLSPEFNERFEWELPLDEA    981 - 1050
QRRKLDVSVKSNSSFMSRERELLGKVQLDLAETDLSQGVARWYDLMDNKDKGSS                   1051 - 1104
//

Text Mined References (29)

PMID Year Title