Property Summary

Ligand Count 32
NCBI Gene PubMed Count 130
PubMed Score 156.69
PubTator Score 169.98

Knowledge Summary

Patent (7,551)

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 5.2e-04
malignant mesothelioma 1.400 1.2e-06

Gene RIF (113)

AA Sequence

MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV      1 - 70
LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL     71 - 140
RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY    141 - 210
AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL    211 - 280
QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ    281 - 350
LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA    351 - 420
MMD                                                                       421 - 423
//

Text Mined References (139)

PMID Year Title