Property Summary

NCBI Gene PubMed Count 121
PubMed Score 151.90
PubTator Score 169.98

Knowledge Summary

Patent (7,551)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.400 1.2e-06
adult high grade glioma -1.100 5.2e-04

Protein-protein Interaction (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (104)

PMID Text
26744532 CD68(+)CD163(+) macrophages secreted cytokines, such as IL17A, that upregulated ERalpha expression.
26639757 Over-expression of ESRRA due to its gene amplification in OSCC
26586335 ERRalpha suppression inhibits angiogenesis in HUVECs
26312764 Incomplete autophagy and cell death by a necrotic processes, as a consequence of the cell energy failure, induced by pharmacological reduction of ERRalpha in adrenocortical carcinoma cells.
26160845 Inhibition of ERRalpha suppresses epithelial mesenchymal transition of triple negative breast cancer cells by directly targeting fibronectin.
25912138 targeting of ERRalpha and pathways regulating transcriptional HIF-2alpha are promising therapeutic avenues in neuroblastoma
25903400 An ERRalpha 23-repeats polymorphisms with BMD in postmenopausal Egyptian women.
25865501 mediates metabolic transition, which is required for induced pluripotency
25643697 our results suggest that ERalpha and ERRalpha cooperate to promote endocrine resistance, and they provide a rationale for the exploration of ERRalpha as a candidate drug target to treat endocrine-resistant breast cancer
25480584 ERRalpha promoted the migration and invasion of A549 cells by inducing EMT, and Slug was involved in the process. Targeting ERRalpha might be an efficient approach for lung cancer treatment.
25288732 control exerted by ERRalpha on RHOA stability is required for directional migration
25266720 miR-125a post-transcriptionally regulates ESRRA in oral squamous cell carcinoma
24979764 Cell cycle dependent oscillatory expression of estrogen receptor-alpha links Pol II elongation to neoplastic transformation.
24967384 this study demonstrated that ERR alpha plays an important role in the development of MTX resistance through blocking MTX-induced ROS production and attenuating the activation of p53 mediated apoptosis signaling pathway
24559156 Estrogen receptor alpha coupled to the Bmi1 regulation pathway plays an important role in breast cancer progression.
24504521 The frequency of the ESRRA/C11orf20 gene fusion in serous ovarian carcinomas of stages III and IV must be very low.
24457025 Data indicate that a stable cell clones have an intact peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha)/estrogen-related receptor alpha (ERRalpha) axis can be used to detect environmental chemicals that act on the signaling pathway.
24425001 ERRalpha can promote the hypoxic growth adaptation of prostate cancer cells via a protective interaction with HIF-1alpha, suggesting ERRalpha as a potential therapeutic target for cancer treatment.
24419103 These results suggest ERRalpha activation as a mechanism of tumor aggressiveness and imply that targeting ERRa may be a promising approach in ovarian cancer treatment.
24216484 analysis of twenty members across three generations identified a rare missense mutation in the estrogen-related receptor alpha (ESRRA) gene that segregated with eating disorders
23836899 analysis of clinical datasets from liver tissues showed a negative correlation between expressions of ERRalpha and PTEN in patients with liver cancer.
23788330 There are 3 ERRalpha response elements (ERR response element, ERRE) in the osteocalcin promoter, and ERRalpha interacted cooperatively with PGC-1alpha could improve the osteocalcin promoter activity.
23720198 ERRalpha coordinates colon cancer cell proliferation and tumorigenic capacity with energy metabolism.
23700042 ERRalpha is downregulated in uterosacral ligaments in pelvic organ prolapse
23680656 ERRa and OPN are co-expressed and higher in colorectal cancer cells as opposed to normal mucosa. Data provide compelling evidence that OPN is a direct target of ERRa, the induction of which could clearly contribute to colorectal cancer pathogenesis.
23525223 the expression of ERRalpha mRNA was significantly increased during the late stage of osteogenic differentiation of human periodontal ligament tissue-derived mesenchymal stem cells.
23516535 the role played by ERRalpha in the regulation of lactate dehydrogenases A and B
23403054 ERRalpha can act as a transcriptional activator of Runx2-I in presence of peroxisome proliferator activated receptor gamma coactivator-1 alpha (PGC-1alpha).
23123734 A possible role of ERRalpha in adrenal development and adrenocortical carcinoma.
22333182 Data identify ERRalpha as a new regulator of the Wnt-signaling pathway during osteoblast differentiation, through a cell-intrinsic mechanism not affecting beta-catenin nuclear translocation.
22266318 these data suggest that RaRF sequesters ERRalpha in the nucleolus through a specific interaction, thereby inhibiting its transcriptional activity.
22096509 Data observed in DMD and aging skeletal muscle enrichment in motifs for candidate transcription factors that may coordinate either the immune/fibrosis responses (ETS1, IRF1, NF1) or the mitochondrial metabolism (ESRRA).
22082156 Knockdown of estrogen-related receptor alpha (ESRRA) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22014575 PGC-1beta knockdown in breast cancer cells impairs ERRalpha signaling and reduces cell proliferation, implicating a functional role for PGC-1beta/ERRalpha in the pathogenesis of breast cancers.
21734015 elevated expression of ERRalpha mRNA in breast carcinomas was associated with high expression of OPG and VEGF and with disease progression.
21732060 ERRalpha-induced adipogenesis is triggered by modulating the expression of PGC-1beta.
21596133 ERRalpha plays an important role down-stream of PKCepsilon to regulate mitochondrial homeostasis.
21546870 ERRalpha affects VEGF expression and tumor growth in cervical cancer.
21513704 estrogen related receptor alpha suppresses
21506092 ERR alpha expression was lower in osteoarthritis than in normal articular cartilage. ERRalpha expression is regulated by IL-1beta in COX-2-, cAMP-, and PKA-dependent pathways in osteoarthritic chondrocytes.
21486805 Striated muscle activator of Rho signalling (STARS) is a PGC-1alpha/oestrogen-related receptor-alpha target gene and is upregulated in human skeletal muscle after endurance exercise.
21449913 Exposure to XCT790, a synthetic inverse agonist of the orphan nuclear oestrogen-related receptor alpha (ERRalpha), also induced EGFR and HB-EGF expression to the same extent as AM251.
21447778 Single nucleotide polymorphism in ESRRA gene is associated with epithelial ovarian cancer.
21190936 a novel function for ERK8 as a bona fide ERRalpha corepressor, involved in control of its cellular localization by nuclear exclusion, and suggest a key role for this MAP kinase in the regulation of the biological activities of this nuclear receptor.
21177257 Parkin degrades ESRRA, ESRRB and ESRRG to limit the expression of MAOA and MAOB.
20961995 ERRalpha and PGC-1beta are key players in the etiology of breast cancer by coordinating the transcriptional regulation of genes located in the 17q12 region, a process that also involves interference with the repressive function of ERalpha on ERBB2 expression.
20870744 Data provide evidence for an autocrine regulatory loop involving transcriptional upregulation of WNT11 by ERRalpha and beta-cat that influences the migratory capacity of cancer cells.
20851810 Baicalin stimulates angiogenesis by inducing VEGF expression through the activation of the ERRalpha/PGC-1alpha pathway.
20838448 PPARalpha promoter variant impairs ERRA and ERRG dependent transactivation and decreases mortality after acute coronary ischemia in patients with diabetes.
20668045 Increased expression of ERRalpha may play a role in altering the bioenergetics of decidualized ESC in preparation for implantation of the embryo and successful establishment of early pregnancy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20561910 Taken together, these results confirm the direct interaction of NRF-1 and ERR alpha with PGC-1 beta, and their participation in mitochondrial biogenesis and respiration.
20497091 This review focuses on the overall developments and recent advances in understanding the role of ERRalpha in metabolism and other biological functions, including its role in human diseases.
20351196 ERRalpha contributed to local estrogen production by up-regulating aromatase expression in response to prostaglandin E2.
20211987 Data show that GPER-1 mediate the regulation of ERRalpha gene expression by estrogen receptor agonists and antagonists in SKBR3 breast cancer cells.
20067526 We therefore hypothesize that the ERRalpha-PRC complex plays a role in arresting the cell cycle through the regulation of oxidative phosphorylation in oxidative cells, and through some other pathway in glycolytic cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822186 These results indicate that ERRalpha and ERRgamma are differentially expressed in these tumor cell lines and likely contribute to agonist-dependent ERR transcriptional activity.
19622763 The identification and functional characterization of the ERRalpha transcriptional network implicate ERRalpha signaling as a determinant of breast cancer heterogeneity.
19608650 role in bone mass regulation by affecting osteoblastic differentiation
19546226 Down regulation of ERRalpha expression inhibits cell proliferation.
19491275 ERRalpha/AIB1 complexes may control estradiol-regulated genes in a hormone-independent manner
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429439 Data show that activation of estrogen-related receptor alpha in several different breast cancer cell lines leads to a significant increase in VEGF mRNA expression, an activity that translates into an increase in VEGF protein secretion.
19389810 DHEA production is regulated by PGC-1alpha, ERRalpha, and HNF4alpha
19276159 A subset of genes involved in ERRalpha signaling in vitro were evaluated and confirmed in vivo by studying uterine gene expression profiles.
19264843 cAMP/PKA signaling enhances ERRalpha phosphorylation and nuclear localization, recruitment to the SP-A promoter, and interaction with PKAcat and SRC-2, resulting in the up-regulation of SP-A gene transcription.
19171140 Kaempferol is an estrogen-related receptor alpha inverse agonist.
19138740 A positive correlation between ERRalpha and c-myc at the transcriptional level and statistically significant positive correlation between aromatase and the ERRalpha at protein level, is demonstrated.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19061896 Results implicate PGC-1alpha and ERRalpha in the pathophysiology of human heart failure.
18974123 results confirm a role for ERRalpha in breast cancer growth and highlight it as a potential therapeutic target for estrogen receptor-negative breast cancer
18778951 The importance of ERRalpha for adaptive energy metabolism suggest that strategies targeting ERRalpha may be useful in fighting metabolic diseases.
18697814 ERRalpha activates the expression of androgen response elements (ARE)-containing promoters, such as that of the prostate cancer marker PSA, in an ARE-dependent manner.
18673300 Results describe the mapping of the nucleosome positions of the estrogen-related receptor alpha gene promoter and examine the changes of histone acetylation in response to peroxisome proliferator-activated receptor-gamma coactivator-1alpha expression.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18509053 Receptor estrogen-related receptors alpha, beta and gamma physically interact with HIF and stimulate HIF-induced transcription in tumor cells cultured under hypoxia.
18418639 The association between LRP5 V667M and LS BMD is confirmed but not that between ESRRA repeats and LS BMD.
18331830 These findings reveal a new function for TNNI2 as a co-activator of ERRalpha.
18328649 ERRalpha (estrogen-related receptor alpha estrogen receptor-like 1) mRNA levels decreased from normal vagina of the pre-menopausal women to atrophic vaginal tissue in post-menopausal women
18174157 17beta-estradiol induces ERRalpha gene expression in MCF-7 cells through active recruitment of co-activators and release of co-repressors when ERRalpha and AP1 bind and ERalpha is tethered to the multiple hormone-response element
17631492 ERR alpha can be deactivated by the synthetic molecule XCT790. Here we demonstrate that this compound also induces a proteasome degradation of ERR alpha
17556356 analysis of human estrogen-related receptor alpha in complex with a synthetic inverse agonist
17509876 Although ERRalpha is not directly related to growth of ovarian cancer, ERRalpha is a candidate for prognostic factors for ovarian cancer.
17418099 Our results indicate an essential role for ERRalpha as a key regulator of oxidative metabolism.
17418098 Our results indicate that EFP functions as a cofactor for ERalpha-mediated transcription.
17294452 enhanced expression of ERRalpha might play a role in the development of human prostate cancer and serve as a significant prognostic factor for the disease
17053040 analysis of estrogen receptor-related receptor-alpha-cofactor interactions
16755280 Observational study of gene-disease association. (HuGE Navigator)
16681769 Up-regulation of estrogen-related receptor alpha is associated with endometrial adenocarcinoma
16150865 A single nucleotide in an ERRalpha binding site can determine specific configuration to the receptor and productive interaction with the coactivator PGC-1alpha.
15883633 Observational study of gene-disease association. (HuGE Navigator)
15883633 a polymorphism of ESSRA may have a role in regulating lumbar spine bone mineral density
15821111 Data demonstrate that the multi-hormone response element of the estrogen-related receptor-alpha (ERRalpha) gene is a target for ERRgamma transactivation, which is enhanced by peroxisome proliferator-activated receptor-gamma coactivator-1alpha.
15598686 ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells.
15337744 study of the crystal structure of ERRalpha ligand binding domain in complex with peroxisome proliferator-activated receptor coactivator-1alpha
15231680 ERRalpha possibly modulates the expression of ERE-containing estrogen-responsive genes, and ERRalpha immunoreactivity is a potent prognostic factor in human breast carcinoma.
14978033 an interdependent ERRalpha/PGC-1alpha-based transcriptional pathway targets the ESRRA23 element to dictate ERRalpha expression level; regulatory polymorphism studied may provide differential responses to ERRalpha/PGC-1alpha-mediated metabolic cues
14610283 ERR alpha 1 has a potential role in the regulation of eNOS expression and may stimulate NO production by endothelial cells
12579315 VEGF-A is an estrogen responsive gene and modulation of this gene expression by estrogen is biphasic and can be mediated through ER-alpha dependent pathway.
12560563 interacts with a conserved domain of EBNA-LP (Epstein-Barr virus nuclear antigen-leader protein) that is critical for Epstein-Barr virus-induced B-cell immortalization
12522104 ERRalpha has a role in the induction of fatty acid oxidation enzyme MCAD by PGC-1 in human cells
12397057 directly associates with PGC-1(ALPHA) and has a similar pattern of expression
11986328 ERRalpha1 can play a critical role in the etiology of some breast cancers

AA Sequence

MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV      1 - 70
LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL     71 - 140
RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY    141 - 210
AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL    211 - 280
QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ    281 - 350
LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA    351 - 420
MMD                                                                       421 - 423
//

Text Mined References (129)

PMID Year Title
26744532 2016 Infiltrating Macrophages Induce ER? Expression through an IL17A-mediated Epigenetic Mechanism to Sensitize Endometrial Cancer Cells to Estrogen.
26639757 2015 Genomic amplification upregulates estrogen-related receptor alpha and its depletion inhibits oral squamous cell carcinoma tumors in vivo.
26586335 2015 Downregulation of ERR? inhibits angiogenesis in human umbilical vein endothelial cells through regulating VEGF production and PI3K/Akt/STAT3 signaling pathway.
26312764 2015 Estrogen related receptor ? (ERR?) a promising target for the therapy of adrenocortical carcinoma (ACC).
26160845 2015 Inhibition of ERR? suppresses epithelial mesenchymal transition of triple negative breast cancer cells by directly targeting fibronectin.
25912138 2015 Differential regulation of HIF-1? and HIF-2? in neuroblastoma: Estrogen-related receptor alpha (ERR?) regulates HIF2A transcription and correlates to poor outcome.
25903400 2015 Association of estrogen receptor ? and estrogen-related receptor ? gene polymorphisms with bone mineral density in postmenopausal women.
25865501 2015 ERRs Mediate a Metabolic Switch Required for Somatic Cell Reprogramming to Pluripotency.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25643697 2015 Reprogramming of the ERR? and ER? target gene landscape triggers tamoxifen resistance in breast cancer.
25480584 2014 Effects of estrogen-related receptor alpha (ERR?) on proliferation and metastasis of human lung cancer A549 cells.
25288732 2014 Estrogen-related receptor ? decreases RHOA stability to induce orientated cell migration.
25266720 2014 MicroRNA-125a reduces proliferation and invasion of oral squamous cell carcinoma cells by targeting estrogen-related receptor ?: implications for cancer therapeutics.
24979764 2014 Cell cycle dependent oscillatory expression of estrogen receptor-? links Pol II elongation to neoplastic transformation.
24967384 2014 Estrogen-related receptor alpha confers methotrexate resistance via attenuation of reactive oxygen species production and P53 mediated apoptosis in osteosarcoma cells.
24559156 2014 Estrogen receptor ?-coupled Bmi1 regulation pathway in breast cancer and its clinical implications.
24504521 2014 Low frequency of ESRRA-C11orf20 fusion gene in ovarian carcinomas.
24457025 2014 Development of a stable cell line with an intact PGC-1?/ERR? axis for screening environmental chemicals.
24425001 2014 ERR? augments HIF-1 signalling by directly interacting with HIF-1? in normoxic and hypoxic prostate cancer cells.
24419103 2014 Targeting estrogen-related receptor alpha inhibits epithelial-to-mesenchymal transition and stem cell properties of ovarian cancer cells.
24216484 2013 Eating disorder predisposition is associated with ESRRA and HDAC4 mutations.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
23836899 2013 Phosphatase and tensin homolog deleted on chromosome 10 (PTEN) signaling regulates mitochondrial biogenesis and respiration via estrogen-related receptor ? (ERR?).
23788330 2013 Estrogen-related receptor alpha interacts cooperatively with peroxisome proliferator-activated receptor-gamma coactivator-1alpha to regulate osteocalcin gene expression.
23720198 2013 ERR? metabolic nuclear receptor controls growth of colon cancer cells.
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
23680656 2013 Control of the human osteopontin promoter by ERR? in colorectal cancer.
23525223 2013 Estrogen-related receptor ? is involved in the osteogenic differentiation of mesenchymal stem cells isolated from human periodontal ligaments.
23516535 2013 Estrogen-related receptor alpha modulates lactate dehydrogenase activity in thyroid tumors.
23403054 2013 Estrogen Receptor ? (ER?) and Estrogen Related Receptor ? (ERR?) are both transcriptional regulators of the Runx2-I isoform.
23123734 2013 Estrogen-related receptor ? in normal adrenal cortex and adrenocortical tumors: involvement in development and oncogenesis.
22333182 2012 Estrogen-related receptor ? regulates osteoblast differentiation via Wnt/?-catenin signaling.
22266318 2012 Negative regulation of ERR? by a novel nucleolar protein.
22096509 2011 Immune response and mitochondrial metabolism are commonly deregulated in DMD and aging skeletal muscle.
22014575 2011 The metabolic regulator ERR?, a downstream target of HER2/IGF-1R, as a therapeutic target in breast cancer.
21949640 2011 ESRRA-C11orf20 is a recurrent gene fusion in serous ovarian carcinoma.
21734015 2011 Dual function of ERR? in breast cancer and bone metastasis formation: implication of VEGF and osteoprotegerin.
21732060 2012 Estrogen related receptor ?-induced adipogenesis is PGC-1?-dependent.
21596133 2011 Protein kinase C epsilon affects mitochondrial function through estrogen-related receptor alpha.
21546870 2011 Estrogen-related receptor ? expression and function are associated with vascular endothelial growth factor in human cervical cancer.
21513704 2011 Estrogen-related receptor ERR?-mediated downregulation of human hydroxysteroid sulfotransferase (SULT2A1) in Hep G2 cells.
21506092 2011 Estrogen receptor-related receptor ? regulation by interleukin-1? in prostaglandin E(2)- and cAMP-dependent pathways in osteoarthritic chondrocytes.
21486805 2011 Striated muscle activator of Rho signalling (STARS) is a PGC-1?/oestrogen-related receptor-? target gene and is upregulated in human skeletal muscle after endurance exercise.
21449913 2011 The cannabinoid receptor inverse agonist AM251 regulates the expression of the EGF receptor and its ligands via destabilization of oestrogen-related receptor ? protein.
21447778 2011 Inherited variants in mitochondrial biogenesis genes may influence epithelial ovarian cancer risk.
21190936 2011 Extracellular signal-regulated kinase 8 (ERK8) controls estrogen-related receptor ? (ERR?) cellular localization and inhibits its transcriptional activity.
21177257 2011 Parkin degrades estrogen-related receptors to limit the expression of monoamine oxidases.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20961995 2010 Transcriptional control of the ERBB2 amplicon by ERRalpha and PGC-1beta promotes mammary gland tumorigenesis.
20870744 2010 WNT11 expression is induced by estrogen-related receptor alpha and beta-catenin and acts in an autocrine manner to increase cancer cell migration.
20851810 2011 Baicalin increases VEGF expression and angiogenesis by activating the ERR{alpha}/PGC-1{alpha} pathway.
20838448 2010 A PPAR? promoter variant impairs ERR-dependent transactivation and decreases mortality after acute coronary ischemia in patients with diabetes.
20668045 2010 A Role for the orphan nuclear receptor estrogen-related receptor alpha in endometrial stromal cell decidualization and expression of genes implicated in energy metabolism.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20561910 2010 PGC-1 beta-regulated mitochondrial biogenesis and function in myotubes is mediated by NRF-1 and ERR alpha.
20497091 2010 The estrogen-related receptor alpha: the oldest, yet an energetic orphan with robust biological functions.
20484414 2010 An acetylation switch modulates the transcriptional activity of estrogen-related receptor alpha.
20351196 2010 Estrogen receptor-related receptor alpha mediates up-regulation of aromatase expression by prostaglandin E2 in prostate stromal cells.
20211987 2010 Regulation of ERRalpha gene expression by estrogen receptor agonists and antagonists in SKBR3 breast cancer cells: differential molecular mechanisms mediated by g protein-coupled receptor GPR30/GPER-1.
20067526 2010 Estrogen-related receptor alpha and PGC-1-related coactivator constitute a novel complex mediating the biogenesis of functional mitochondria.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822186 2010 Identification and characterization of estrogen receptor-related receptor alpha and gamma in human glioma and astrocytoma cells.
19622763 2009 Genome-wide identification of direct target genes implicates estrogen-related receptor alpha as a determinant of breast cancer heterogeneity.
19608650 2009 Absence of estrogen receptor-related-alpha increases osteoblastic differentiation and cancellous bone mineral density.
19546226 2009 Modulating estrogen receptor-related receptor-alpha activity inhibits cell proliferation.
19491275 2009 Estrogen-related receptor alpha expression and function is associated with the transcriptional coregulator AIB1 in breast carcinoma.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429439 2009 Estrogen-related receptor alpha induces the expression of vascular endothelial growth factor in breast cancer cells.
19389810 2009 Fasting-induced hepatic production of DHEA is regulated by PGC-1alpha, ERRalpha, and HNF4alpha.
19276159 2009 Estrogen-related receptor-alpha antagonist inhibits both estrogen receptor-positive and estrogen receptor-negative breast tumor growth in mouse xenografts.
19264843 2009 cAMP enhances estrogen-related receptor alpha (ERRalpha) transcriptional activity at the SP-A promoter by increasing its interaction with protein kinase A and steroid receptor coactivator 2 (SRC-2).
19171140 2009 Kaempferol is an estrogen-related receptor alpha and gamma inverse agonist.
19138740 2009 The significance of the expression of ERRalpha as a potential biomarker in breast cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19061896 2009 PGC-1alpha and ERRalpha target gene downregulation is a signature of the failing human heart.
18974123 2008 Estrogen-related receptor alpha is critical for the growth of estrogen receptor-negative breast cancer.
18778951 2008 ERRalpha: a metabolic function for the oldest orphan.
18697814 2008 The orphan receptor ERRalpha interferes with steroid signaling.
18673300 2008 PGC-1alpha induces dynamic protein interactions on the ERRalpha gene multi-hormone response element nucleosome in kidney cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18509053 2008 Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors.
18441008 2008 Communication between the ERRalpha homodimer interface and the PGC-1alpha binding surface via the helix 8-9 loop.
18418639 2008 Replication of associations between LRP5 and ESRRA variants and bone density in premenopausal women.
18331830 2008 Fast skeletal muscle troponin I is a co-activator of estrogen receptor-related receptor alpha.
18328649 2008 Estrogen receptor (ER) and ER-related receptor expression in normal and atrophic human vagina.
18174157 2008 Estrogen induces estrogen-related receptor alpha gene expression and chromatin structural changes in estrogen receptor (ER)-positive and ER-negative breast cancer cells.
18063693 2008 Phosphorylation-dependent sumoylation regulates estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif.
17676930 2007 Phosphorylation-dependent sumoylation of estrogen-related receptor alpha1.
17631492 2007 Potentiation of ICI182,780 (Fulvestrant)-induced estrogen receptor-alpha degradation by the estrogen receptor-related receptor-alpha inverse agonist XCT790.
17556356 2007 Crystal structure of human estrogen-related receptor alpha in complex with a synthetic inverse agonist reveals its novel molecular mechanism.
17509876 2007 Clinical implication of estrogen-related receptor (ERR) expression in ovarian cancers.
17418099 2007 Estrogen-related receptor alpha is essential for the expression of antioxidant protection genes and mitochondrial function.
17418098 2007 Ligand-dependent transcription of estrogen receptor alpha is mediated by the ubiquitin ligase EFP.
17294452 2007 Increased expression of estrogen-related receptor alpha (ERRalpha) is a negative prognostic predictor in human prostate cancer.
17053040 2007 Definition of the molecular basis for estrogen receptor-related receptor-alpha-cofactor interactions.
16755280 2007 Genetic analysis of the estrogen-related receptor alpha and studies of association with obesity and type 2 diabetes.
16681769 Expression of estrogen receptor-related receptor isoforms and clinical significance in endometrial adenocarcinoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16150865 2006 A single nucleotide in an estrogen-related receptor alpha site can dictate mode of binding and peroxisome proliferator-activated receptor gamma coactivator 1alpha activation of target promoters.
15883633 2005 A frequent regulatory variant of the estrogen-related receptor alpha gene associated with BMD in French-Canadian premenopausal women.
15821111 2005 Estrogen-related receptor-gamma and peroxisome proliferator-activated receptor-gamma coactivator-1alpha regulate estrogen-related receptor-alpha gene expression via a conserved multi-hormone response element.
15598686 2005 Expression and functional study of estrogen receptor-related receptors in human prostatic cells and tissues.
15337744 2004 Evidence for ligand-independent transcriptional activation of the human estrogen-related receptor alpha (ERRalpha): crystal structure of ERRalpha ligand binding domain in complex with peroxisome proliferator-activated receptor coactivator-1alpha.
15318176 2004 Nuclear insulin receptor substrate 1 interacts with estrogen receptor alpha at ERE promoters.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
15231680 2004 Estrogen-related receptor alpha in human breast carcinoma as a potent prognostic factor.
14978033 2004 A polymorphic autoregulatory hormone response element in the human estrogen-related receptor alpha (ERRalpha) promoter dictates peroxisome proliferator-activated receptor gamma coactivator-1alpha control of ERRalpha expression.
14610283 2003 Estrogen-related receptor alpha 1 up-regulates endothelial nitric oxide synthase expression.
12579315 2003 Estradiol-induced vascular endothelial growth factor-A expression in breast tumor cells is biphasic and regulated by estrogen receptor-alpha dependent pathway.
12560563 2003 Physical interaction of Epstein-Barr virus (EBV) nuclear antigen leader protein (EBNA-LP) with human oestrogen-related receptor 1 (hERR1): hERR1 interacts with a conserved domain of EBNA-LP that is critical for EBV-induced B-cell immortalization.
12522104 2003 The transcriptional coactivator PGC-1 regulates the expression and activity of the orphan nuclear receptor estrogen-related receptor alpha (ERRalpha).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397057 2002 Identification of a specific molecular repressor of the peroxisome proliferator-activated receptor gamma Coactivator-1 alpha (PGC-1alpha).
11986328 2002 Estrogen-related receptor alpha 1 actively antagonizes estrogen receptor-regulated transcription in MCF-7 mammary cells.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11574675 2001 PNRC2 is a 16 kDa coactivator that interacts with nuclear receptors through an SH3-binding motif.
11437591 2001 Overexpression, purification, and crystal structure of native ER alpha LBD.
11165056 2001 Estrogen receptor alpha and estrogen receptor-related receptor alpha1 compete for binding and coactivator.
9824153 1998 Activation of the thyroid hormone receptor alpha gene promoter by the orphan nuclear receptor ERR alpha.
9344655 1997 Chromosomal mapping of the human and murine orphan receptors ERRalpha (ESRRA) and ERRbeta (ESRRB) and identification of a novel human ERRalpha-related pseudogene.
9286700 1997 Human estrogen receptor-like 1 (ESRL1) gene: genomic organization, chromosomal localization, and promoter characterization.
9271417 1997 The orphan nuclear receptor estrogen-related receptor alpha is a transcriptional regulator of the human medium-chain acyl coenzyme A dehydrogenase gene.
9058380 1997 Estrogen-related receptor alpha 1 functionally binds as a monomer to extended half-site sequences including ones contained within estrogen-response elements.
8621448 1996 Estrogen-related receptor, hERR1, modulates estrogen receptor-mediated response of human lactoferrin gene promoter.
8224847 1993 SV40 early-to-late switch involves titration of cellular transcriptional repressors.
3267207 1988 Identification of a new class of steroid hormone receptors.