Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.02
PubTator Score 6.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.100 5.5e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
interstitial cystitis -2.500 1.1e-04
spina bifida -1.617 4.4e-02
ductal carcinoma in situ 1.900 2.9e-03
invasive ductal carcinoma 2.400 3.7e-03

Gene RIF (6)

PMID Text
26531099 Findings define a direct role for ESRP2 in the generation of conserved repertoires of adult splice isoforms that facilitate terminal differentiation and maturation of hepatocytes.
25143390 ESRP1 and ESRP2 suppress cancer cell motility via different mechanisms.
22354987 functions of the ESRP2 in an epithelial posttranscriptional gene expression program.
20711167 ESRP2 coordinates a complex alternative splicing network that adds an important post-transcriptional layer to the changes in gene expression that underlie epithelial-mesenchymal transitions during development and disease.
19829082 results further establish ESRP1 and ESRP2 as global regulators of an epithelial splicing regulatory network.
19285943 ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.

AA Sequence

MTPPPPPPPPPGPDPAADPAADPCPWPGSLVVLFGATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTL      1 - 70
HKSLVRAEAAALSTQCREASGLSADSLARAEPLDKVLQQFSQLVNGDVALLGGGPYMLCTDGQQLLRQVL     71 - 140
HPEASRKNLVLPDMFFSFYDLRREFHMQHPSTCPARDLTVATMAQGLGLETDATEDDFGVWEVKTMVAVI    141 - 210
LHLLKEPSSQLFSKPEVIKQKYETGPCSDSTVPCPYSSKADVVDSETVVRARGLPWQSSDQDVARFFKGL    211 - 280
NVARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHMGVRYIEVYKATGEEFVKIAGGTSLEVAR    281 - 350
FLSREDQVILRLRGLPFSAGPTDVLGFLGPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALR    351 - 420
RHKGMLGKRYIELFRSTAAEVQQVLNRYASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATIED    421 - 490
ILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKVMKERYVEVVPCSTEEMSR    491 - 560
VLMGGTLGRSGMSPPPCKLPCLSPPTYTTFQATPTLIPTETAALYPSSALLPAARVPAAPTPVAYYPGPA    561 - 630
TQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLP    631 - 700
ADDYTSLMPVGDPPRTVLQAPKEWVCL                                               701 - 727
//

Text Mined References (18)

PMID Year Title
26531099 2015 ESRP2 controls an adult splicing programme in hepatocytes to support postnatal liver maturation.
25143390 2014 Epithelial splicing regulatory proteins 1 (ESRP1) and 2 (ESRP2) suppress cancer cell motility via different mechanisms.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22354987 2012 Genome-wide determination of a broad ESRP-regulated posttranscriptional network by high-throughput sequencing.
21269460 2011 Initial characterization of the human central proteome.
20711167 2010 An ESRP-regulated splicing programme is abrogated during the epithelial-mesenchymal transition.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19829082 The epithelial splicing factors ESRP1 and ESRP2 positively and negatively regulate diverse types of alternative splicing events.
19285943 2009 ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.