Property Summary

NCBI Gene PubMed Count 21
PubMed Score 37.40
PubTator Score 21.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (15)

PMID Text
26522352 MCL1 with the deletion of 801G and 802A sites could not be correctly spliced by ESRP1 and no significant difference was seen in the expressions of isoform 1 and 3 in mutant MCL1
25143390 ESRP1 and ESRP2 suppress cancer cell motility via different mechanisms.
24077287 Results show that ESRP1 regulates the expression pattern of FGFR-2 isoforms, attenuates cell growth, migration, invasion and metastasis, and is a favorable prognostic factor in pancreatic ductal adenocarcinoma.
23825128 Data suggest that alternative splicing in ESRP1 transcripts in somatotroph adenomas is essential in epithelial-mesenchymal transition progression and in response to somatostatin analog antineoplastic treatment.
23299472 ESRP1 and PNN modulate alternative splicing of a specific subset of target genes, but not general splicing events, in HCET cells to maintain or enhance epithelial characteristics.
22961986 the transcription repressor Snail binds to E-boxes in the ESRP1 promoter, causing repression of the ESRP1 gene.
22585092 ESRP1 could be a master regulator of the EMT process in pituitary adenomas causing acromegaly.
22354987 functions of the ESRP1 in an epithelial posttranscriptional gene expression program.
22037216 deltaEF1 family proteins repress the expression of ESRPs to regulate alternative splicing during TGF-beta-induced EMT and the progression of breast cancers
21876675 The functional significance of EMT-associated alternative splicing was tested by expression of the epithelial-specific splicing factor ESRP1
20711167 ESRP1 coordinates a complex alternative splicing network that adds an important post-transcriptional layer to the changes in gene expression that underlie epithelial-mesenchymal transitions during development and disease.
19829082 results further establish ESRP1 and ESRP2 as global regulators of an epithelial splicing regulatory network.
19285943 ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.
19177006 Results demonstrate that RBM35A functions as a tumor suppressor in colon cancer cells, and suggest that RBM35A is involved in posttranscriptional regulation of a number of genes by exerting a differential effect on protein translation via 5'UTRs of mRNAs.
17145811 The FLJ20171 gene was shown to effectively separate these two chromophobe renal cell carcinoma (RCC) and benign oncocytoma groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues.

AA Sequence

MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI      1 - 70
DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR     71 - 140
KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF    141 - 210
ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD    211 - 280
LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC    281 - 350
PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP    351 - 420
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD    421 - 490
AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLPCLSPPSYTFP    491 - 560
APAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQ    561 - 630
PGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGLIHTNDQARTLPKEWVCI                       631 - 681
//

Text Mined References (24)

PMID Year Title
26522352 2015 [The myeloid cell leukemia-1 mRNA splicing mediated by epithelial splicing regulatory protein 1 (ESRP1) in glioma U251 cell lines].
25416956 2014 A proteome-scale map of the human interactome network.
25143390 2014 Epithelial splicing regulatory proteins 1 (ESRP1) and 2 (ESRP2) suppress cancer cell motility via different mechanisms.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24077287 2014 Epithelial splicing regulatory protein 1 is a favorable prognostic factor in pancreatic cancer that attenuates pancreatic metastases.
23825128 2013 Epithelial splicing regulator protein 1 and alternative splicing in somatotroph adenomas.
23299472 2013 Transcriptomic analysis of PNN- and ESRP1-regulated alternative pre-mRNA splicing in human corneal epithelial cells.
22961986 2012 Snail represses the splicing regulator epithelial splicing regulatory protein 1 to promote epithelial-mesenchymal transition.
22585092 2012 Gene expression profiling identifies ESRP1 as a potential regulator of epithelial mesenchymal transition in somatotroph adenomas from a large cohort of patients with acromegaly.
22354987 2012 Genome-wide determination of a broad ESRP-regulated posttranscriptional network by high-throughput sequencing.
22037216 2012 TGF-? drives epithelial-mesenchymal transition through ?EF1-mediated downregulation of ESRP.
21876675 2011 An EMT-driven alternative splicing program occurs in human breast cancer and modulates cellular phenotype.
20711167 2010 An ESRP-regulated splicing programme is abrogated during the epithelial-mesenchymal transition.
19829082 The epithelial splicing factors ESRP1 and ESRP2 positively and negatively regulate diverse types of alternative splicing events.
19285943 2009 ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.
19177006 2009 RNA-binding motif protein 35A is a novel tumor suppressor for colorectal cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17145811 2006 Gene expression profiling separates chromophobe renal cell carcinoma from oncocytoma and identifies vesicular transport and cell junction proteins as differentially expressed genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.