Property Summary

NCBI Gene PubMed Count 1,028
PubMed Score 3765.20
PubTator Score 2681.61

Knowledge Summary

Patent (63,928)

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8297 7.0e-07
psoriasis 6514 6.0e-04
lung cancer 4607 3.0e-03

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -1.100 3.0e-03
ovarian cancer -1.300 7.0e-07
psoriasis -1.200 6.0e-04

Gene RIF (1042)

AA Sequence

MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPG      1 - 70
RQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGP     71 - 140
GSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCY    141 - 210
EVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHV    211 - 280
LISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDH    281 - 350
PGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA    351 - 420
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDL    421 - 490
LLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ                                  491 - 530
//

Text Mined References (1031)

PMID Year Title