Property Summary

NCBI Gene PubMed Count 970
PubMed Score 3575.45
PubTator Score 2681.61

Knowledge Summary

Patent (63,928)


  Differential Expression (3)

Disease log2 FC p
psoriasis -1.200 0.001
lung cancer -1.100 0.003
ovarian cancer -1.300 0.000


Accession Q92731 A8K8K5 G3V5M5 O60608 O60685 O60702 O60703 O75583 O75584 Q0MWT5 Q0MWT6 Q86Z31 Q9UEV6 Q9UHD3 Q9UQK9 ER-beta
Symbols Erb



4ZI1   1L2J   1NDE   1QKM   1U3Q   1U3R   1U3S   1U9E   1X76   1X78   1X7B   1X7J   1YY4   1YYE   1ZAF   2FSZ   2GIU   2I0G   2JJ3   2NV7   2QTU   2YJD   2YLY   2Z4B   3OLL   3OLS   3OMO   3OMP   3OMQ   4J24   4J26  

  Ortholog (14)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
633 screening 1114 / 0 / 84992 HTS for Estrogen Receptor-beta Coactivator Binding inhibitors
733 confirmatory 194 / 0 / 196 Estrogen Receptor-beta Coactivator Binding Inhibitors Dose Response Confirmation
1060 confirmatory 4 / 0 / 350 Estrogen Receptor-beta Coactivator Binding Inhibitors ELISA Secondary Assay
1210 screening 58 / 0 / 764 Estrogen Receptor (beta) binding: Primary Screen
1218 screening 3 / 2 / 7 Functional assay for estrogen-mediated translocation of PIP3: Secondary Assay for Estrogen receptor beta
1221 confirmatory 14 / 0 / 49 Estrogen Receptor (beta) binding: Dose Response of Primary Screen Assay
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (986)

27048022 ERbeta expressed in cytoplasm may mediate pathogenesis of EMs.
26903639 Data show that oxytocin receptor and estrogen receptor beta single nucleotide polymorphisms (SNPs) temper accelerated cellular aging in young females who tend to make impatient choices.
26767948 Taken together, silibinin induced apoptosis through mitochondrial pathway by up-regulating ERbeta pathways in MCF-7 cells without the involvement of autophagy.
26742628 the results indicate that there is a crosstalk between ERalpha and ERbeta to regulate the expression of each other, and suggest the involvement of other receptors, such as ER-alpha36, in the rapid ERK1/2 activation by E2.
26728382 Data show that Cyclin D1 has a higher expression in breast cancer, positively correlated with estrogen receptors (ER) and better prognosis.
26709918 obesity-associated systemic factors suppress ERbeta expression in breast cancer cells via a HER2-mediated pathway
26678909 Estrogen receptor Beta-positive cases of squamous cell lung carcinoma were at risk for poor outcome.
26665557 ER-beta expression was most pronounced in benign prostatic hyperplasia samples and declined in malignant prostate lesions. This finding supports statement on anticiproliferative role of ER-beta in prostatic tissue.
26592768 Activation of ERalpha but not ERbeta increases ADAM9 expression in cultured human neuronal cells.
26587829 Infiltrating T cells regulate ERbeta/DAB2IP signals in renal cell carcinoma.

AA Sequence

LLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ                                  491 - 530

Text Mined References (973)

PMID Year Title
27048022 2016 Expression and significance of ER? and TrkB in endometriosis.
26903639 2016 Delay discounting, genetic sensitivity, and leukocyte telomere length.
26767948 2016 ER? up-regulation was involved in silibinin-induced growth inhibition of human breast cancer MCF-7 cells.
26742628 2016 Expression and regulation of the estrogen receptors in PC-3 human prostate cancer cells.
26728382 2016 [High expression of cyclin D1 is correlated with the expression of estrogen receptor and good prognosis in breast cancer].
26709918 2015 Obesity Suppresses Estrogen Receptor Beta Expression in Breast Cancer Cells via a HER2-Mediated Pathway.
26678909 2015 Expression of PAM50 Genes in Lung Cancer: Evidence that Interactions between Hormone Receptors and HER2/HER3 Contribute to Poor Outcome.
26665557 2015 The expression and localization of estrogen receptor beta in hyperplastic and neoplastic prostate lesions.
26592768 2016 Estrogen induced the expression of ADAM9 through estrogen receptor ? but not estrogen receptor ? in cultured human neuronal cells.
26587829 2015 Infiltrating T cells promote renal cell carcinoma (RCC) progression via altering the estrogen receptor ?-DAB2IP signals.