Property Summary

NCBI Gene PubMed Count 38
PubMed Score 261.38
PubTator Score 120.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.000 1.4e-07
esophageal adenocarcinoma -1.500 3.3e-02
psoriasis 1.700 1.4e-03
osteosarcoma -1.636 1.2e-02
glioblastoma 2.000 3.1e-05
group 3 medulloblastoma 2.600 1.7e-06
atypical teratoid / rhabdoid tumor 2.300 4.2e-09
medulloblastoma, large-cell 2.300 1.1e-05
primitive neuroectodermal tumor 2.100 1.6e-05
Atopic dermatitis 1.200 1.9e-05
adrenocortical carcinoma 1.322 7.8e-04
non-small cell lung cancer 1.724 1.8e-24
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-03
colon cancer 1.300 2.2e-02
lung cancer 1.500 1.1e-02
pediatric high grade glioma 1.800 4.4e-07
posterior fossa group A ependymoma 1.300 1.8e-06
Breast cancer 1.900 8.0e-15
invasive ductal carcinoma 1.300 1.2e-04
ovarian cancer 1.600 4.4e-08

Gene RIF (29)

PMID Text
26267133 The assay was used to quantify Separase proteolytic activity in leukemic cell lines and peripheral blood samples from leukemia patients.
26087013 Separase protein levels decrease and Separase proteolytic activity increases exclusively in b3a2 p210BCR-ABL-positive cell lines under Imatinib treatment.
25921067 Data indicate that separase is subject to native-state cis/trans isomerization by peptidyl-prolyl-isomerase Pin1.
25299182 Recruitment and activation of separase at centrosomes are two distinct steps that do not require microtubules.
25086634 High ESPL1 mRNA expression was associated with luminal B breast cancers.
24792645 Separase is an oncogene whose overexpression induces tumorigenesis, and indicate that Separase overexpression and aberrant nuclear localization are common in many tumor types and may predict outcome in some human malignancies.
23798554 Mutation of the homologous position in PTTG1 (H(134)) switched PTTG1 from an inhibitor into an activator of ESP1.
22814604 By consecutively acting as a protease and a cdk1 inhibitor, separase coordinates two key processes to achieve simultaneous and abrupt separation of sister chromatids.
22542101 Kendrin is a novel and crucial substrate for separase (ESPL1) at the centrosome, protecting the engaged centrioles from premature disengagement and thereby blocking reduplication until the cell passes through mitosis.
21272169 Results identify a new functional role of securin and separase in the modulation of membrane traffic and protein secretion that implicates regulation of V-ATPase assembly and function.
21126432 SMC3 and separase are upregulated and securin is downregulated in malignant transformation of BEAS-2B cells induced by coal tar pitch smoke extracts.
21041660 Plk1-mediated phosphorylation of Cdc6 promotes the interaction of Cdc6 and Cdk1, leading to the attenuation of Cdk1 activity, release of separase, and subsequent anaphase progression.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19758559 Plk1 and separase act at different times during M phase to license centrosome duplication, reminiscent of their roles in removing cohesin from chromosomes
19351757 Separase might be an oncogene, whose overexpression induces tumorigenesis. Separase overexpression and aberrant nuclear localization are common in many tumor types and may predict outcome in some human cancers.
19345191 Study reports that cohesin cleavage by human separase requires DNA in a sequence-nonspecific manner.
19342897 Aurora B kinase activity helps coordinate the association of separase with chromosome and the initiation of sister-chromatid separation.
19008095 Observational study of gene-disease association. (HuGE Navigator)
18728194 These results collectively suggest that Separase is an oncogene, whose overexpression alone in mammary epithelial cells is sufficient to induce aneuploidy and tumorigenesis in a p53 mutant background.
18616699 Separase has targets involved in regulation of G(2) to M progression after DNA damage in lung cancer cells.
18003702 The complete removal of cohesin from chromosome arms depends on separase.
17974570 Phosphorylation promotes complex formation indirectly, possibly by inducing a conformational change in full-length separase.
17604273 Protein phosphatase 2A and separase form a complex regulated by separase autocleavage
17102637 nuclear exclusion is important to prevent cohesin cleavage during interphase in the absence of securin and the phosphorylation inhibition
16177575 Separase function is not restricted to anaphase initiation; its role in promoting loss of sister chromatid cohesion might be preferentially at arms but not centromeres.
15880121 density map at a resolution of 25 A of negatively stained separase-securin complex
12672959 Processing, localization, and requirement of separase for normal anaphase progression.
12297314 Anaphase specific auto-cleavage of separase.
12194817 Data suggest that separase is required for sister chromatid separation during mitosis in human cells, and that securin inhibits separase by blocking the access of substrates to the active site of separase.

AA Sequence

MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQLTAKLACPRH      1 - 70
LGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRLAQPLHACLVQCSREAAPQDY     71 - 140
EAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLEDESTPCEVPHFASPTACRAVAAHQLFDASGH    141 - 210
GLNEADADFLDDLLSRHVIRALVGERGSSSGLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHS    211 - 280
YLRNTNLAPSLQLCQLGVKLLQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERG    281 - 350
TKRRYRLDAILSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL    351 - 420
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAISEPLCQHLGLV    421 - 490
KPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPEHMAEPVTFWVRVKMDAARAG    491 - 560
DKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTGQERFNIICDLLELSPEETPAGAWARATHLV    561 - 630
ELAQVLCYHDFTQQTNCSALDAIREALQLLDSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERD    631 - 700
RRAQAPGNLEEFEVNDLNYEDKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQ    701 - 770
QTAASLQILAALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA    771 - 840
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLLRVQVLQLVAA    841 - 910
YLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILSTQKAAVETSFLDYGENLVQK    911 - 980
WQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSD    981 - 1050
LQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIA   1051 - 1120
PSTNSSPVLKTKPQPIPNFLSHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKG   1121 - 1190
CPEAAERLTQALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH   1191 - 1260
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGRQKLASAPLRL   1261 - 1330
NNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQAPRVQQRVQTRLKVNFSDDSD   1331 - 1400
LEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVVAPGSAPGNPGLNGRSRRAKKVASRHCEERR   1401 - 1470
PQRASDQARPGPEIMRTIPEEELTDNWRKMSFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSK   1471 - 1540
KKLPSPCPDKESDKDLGPRLRLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGH   1541 - 1610
RDPYATAFLVTESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR   1611 - 1680
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQIPTGQNKLHL   1681 - 1750
RSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLGCWKGLLLPSSEEPGPAQEAS   1751 - 1820
RLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYGLCPTQPERAQELLNEAVGRLQGLTVPSNSH   1821 - 1890
LVLVLDKDLQKLPWESMPSLQALPVTRLPSFRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSS   1891 - 1960
TEEQFRANFSSEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCS   1961 - 2030
SAALAVRGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP   2031 - 2100
RLKYLIGAAPIAYGLPVSLR                                                     2101 - 2120
//

Text Mined References (45)

PMID Year Title
26267133 2015 Measurement of separase proteolytic activity in single living cells by a fluorogenic flow cytometry assay.
26087013 2015 Clonal Evolution and Blast Crisis Correlate with Enhanced Proteolytic Activity of Separase in BCR-ABL b3a2 Fusion Type CML under Imatinib Therapy.
25921067 2015 Human chromosome segregation involves multi-layered regulation of separase by the peptidyl-prolyl-isomerase Pin1.
25299182 2014 Sensors at centrosomes reveal determinants of local separase activity.
25086634 2014 ESPL1 is a candidate oncogene of luminal B breast cancers.
24792645 2014 Overexpression and constitutive nuclear localization of cohesin protease Separase protein correlates with high incidence of relapse and reduced overall survival in glioblastoma multiforme.
23798554 2013 Critical differences between isoforms of securin reveal mechanisms of separase regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814604 2012 Separase sensor reveals dual roles for separase coordinating cohesin cleavage and cdk1 inhibition.
22542101 2012 Kendrin is a novel substrate for separase involved in the licensing of centriole duplication.
21272169 2011 Securin and separase modulate membrane traffic by affecting endosomal acidification.
21269460 2011 Initial characterization of the human central proteome.
21126432 2010 [Change of structural maintenance of chromosome (SMC)1, SMC3, Separase and Securin expression in BEAS-2B malignant transformation cell induced by coal tar pitch smoke extracts].
21041660 2010 Cell division cycle 6, a mitotic substrate of polo-like kinase 1, regulates chromosomal segregation mediated by cyclin-dependent kinase 1 and separase.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19758559 2009 Polo kinase and separase regulate the mitotic licensing of centriole duplication in human cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19351757 2009 Overexpression and mislocalization of the chromosomal segregation protein separase in multiple human cancers.
19345191 2009 Separase is recruited to mitotic chromosomes to dissolve sister chromatid cohesion in a DNA-dependent manner.
19342897 2009 Recruitment of separase to mitotic chromosomes is regulated by Aurora B.
19008095 2009 Single nucleotide polymorphisms in chromosomal instability genes and risk and clinical outcome of breast cancer: a Swedish prospective case-control study.
18728194 2008 Overexpression of Separase induces aneuploidy and mammary tumorigenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18616699 2008 Effect of separase depletion on ionizing radiation-induced cell cycle checkpoints and survival in human lung cancer cell lines.
18003702 2007 The complete removal of cohesin from chromosome arms depends on separase.
17974570 2008 Phosphorylation-dependent binding of cyclin B1 to a Cdc6-like domain of human separase.
17604273 2007 Protein phosphatase 2A and separase form a complex regulated by separase autocleavage.
17102637 2006 Nuclear exclusion of separase prevents cohesin cleavage in interphase cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
16258266 2005 BRCA1 regulates gene expression for orderly mitotic progression.
16177575 2005 Separase is required at multiple pre-anaphase cell cycle stages in human cells.
15880121 2005 Domain structure of separase and its binding to securin as determined by EM.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12672959 2003 Processing, localization, and requirement of human separase for normal anaphase progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297314 2002 Anaphase specific auto-cleavage of separase.
12194817 2002 Regulation of human separase by securin binding and autocleavage.
11875078 2002 Caspase proteolysis of the cohesin component RAD21 promotes apoptosis.
11747808 2001 Dual inhibition of sister chromatid separation at metaphase.
11509732 2001 Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.
10411507 1999 Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.