Property Summary

NCBI Gene PubMed Count 76
PubMed Score 191.42
PubTator Score 111.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver neoplasms 126 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2388 3.13 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.502 1.7e-03
Astrocytoma, Pilocytic 1.500 1.9e-03
colon cancer 1.700 1.2e-04
cystic fibrosis 5.524 1.8e-08
ependymoma 1.100 3.3e-04
glioblastoma 1.300 3.8e-03
group 3 medulloblastoma 1.700 2.5e-03
interstitial lung disease -1.200 4.6e-02
invasive ductal carcinoma 1.200 9.6e-03
nephrosclerosis 1.439 2.9e-03
ovarian cancer 1.400 3.7e-05
pediatric high grade glioma 1.200 1.8e-03
urothelial carcinoma 1.700 2.8e-02

Gene RIF (69)

AA Sequence

MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVS      1 - 70
GMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVT     71 - 140
KSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR                              141 - 184
//

Text Mined References (79)

PMID Year Title