Property Summary

NCBI Gene PubMed Count 35
PubMed Score 203.94
PubTator Score 286.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.514 8.2e-04
Multiple myeloma 1.983 4.1e-05
astrocytic glioma -1.200 7.8e-03
ependymoma -1.100 2.4e-02
osteosarcoma -1.751 3.9e-06
medulloblastoma -1.200 1.2e-04
Breast cancer 2.600 2.7e-02
cystic fibrosis -1.500 1.1e-05
invasive ductal carcinoma -1.300 1.1e-04
ovarian cancer -2.100 2.8e-11

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (10)

PMID Text
26337638 rs7996797 located on chr13q14.1-q14.2 near the ESD gene was the most significantly associated with hallux valgus in females in genome-wide association meta-analyses.
22944692 Positional proteomics analysis identifies the cleavage of human esterase D (ESD; S-formylglutathione hydrolase) at amino acid residues 76-77 by the HIV-1 protease
21596165 Abhydrolase domain-containing protein 11 and Esterase D predict the development of distant metastases and the presence of aggressive lung adenocarcinomas.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19126594 catalytic triad residues--Ser-153, His264, and Asp230--involved in catalysis. Mutagenesis of any of the catalytic triad residues to alanine abolished the enzyme activity. Backbone amides of Leu54 & Met150 are involved in the formation of the oxyanion hole
18552983 Autoantibodies to EsteD and BB-CK produced in experimental autoimmune uveoretinitis -induced mice were also detected in some endogenous uveitis patients, suggesting that these proteins might be autoantigens.
12942785 The analysis involved the data on nine polymorphic codominant loci: HP, GC, TF, PI, PGM1, GLO1, C3, ACP1, and ESD. The loci were selected by significance of differences in genotype frequencies between tuberculosis patients and healthy controls
11963573 Observational study of genotype prevalence. (HuGE Navigator)
11785295 Observational study of gene-disease association. (HuGE Navigator)
11436564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS      1 - 70
ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP     71 - 140
QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS    141 - 210
YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYL    211 - 280
NA                                                                        281 - 282
//

Text Mined References (40)

PMID Year Title
26337638 2015 Genome-wide association meta-analyses to identify common genetic variants associated with hallux valgus in Caucasian and African Americans.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21596165 2011 Activity-based proteomics: identification of ABHD11 and ESD activities as potential biomarkers for human lung adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19126594 2009 Crystal structure of human esterase D: a potential genetic marker of retinoblastoma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18552983 2008 Proteomic surveillance of retinal autoantigens in endogenous uveitis: implication of esterase D and brain-type creatine kinase as novel autoantigens.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12942785 2003 [The use of discrete characters in discriminant analysis for diagnosis of pulmonary tuberculosis and for classification of patients differing in treatment efficiency based on polymorphisms at nine codominant loci-HP, GC, TF, PI, PGM1, GLO1, C3, ACP1 and ESD].
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11963573 2002 [Genetic polymorphism of erythrocytic enzymes in Yakut populations].
11785295 2001 [Analysis of heterozygosity levels at P1,TF, PGM1, ACP1, HP, GC, GLO, C3, and ESD loci in pulmonary tuberculosis patients with different treatment outcomes].
11436564 2001 [Genetic predisposition to development of toxic liver cirrhosis caused by alcohol].
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
7907313 1994 Molecular analysis of esterase D polymorphism.
7821789 1994 Construction of a human full-length cDNA bank.
7375916 1980 Regional assignment of genes for human esterase D and retinoblastoma to chromosome band 13q14.
6823558 1983 Gene for hereditary retinoblastoma assigned to human chromosome 13 by linkage to esterase D.
4768551 1973 Esterase D: a new human polymorphism.
3770744 1986 Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.
3591015 1987 Genetic study of red cell esterase D polymorphism by ultrathin layer isoelectric focusing. Distribution in the Veneto population (Italy).
3462728 1986 Purification, biochemical characterization, and biological function of human esterase D.
3462714 1986 Cloning of the esterase D gene: a polymorphic gene probe closely linked to the retinoblastoma locus on chromosome 13.
3462698 1986 Molecular cloning of the human esterase D gene, a genetic marker of retinoblastoma.
3459695 1986 Evidence for linkage between Wilson disease and esterase D in three kindreds: detection of linkage for an autosomal recessive disorder by the family study method.
3456572 1986 A sialic acid-specific O-acetylesterase in human erythrocytes: possible identity with esterase D, the genetic marker of retinoblastomas and Wilson disease.
3164702 1988 Human esterase D gene: complete cDNA sequence, genomic structure, and application in the genetic diagnosis of human retinoblastoma.
1886375 1991 [Lausanne study of retinoblastoma, 1986-90: deletion of esterase D locus in a collective of 128 patients].
1137344 1975 Chromosome assignment of some human enzyme loci: mitochondrial malate dehydrogenase to 7, mannosephosphate isomerase and pyruvate kinase to 15 and probably, esterase D to 13.