Property Summary

NCBI Gene PubMed Count 20
PubMed Score 373.85
PubTator Score 29.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.200 4.7e-04
interstitial cystitis 1.200 5.7e-04
invasive ductal carcinoma -1.200 5.0e-03
lung adenocarcinoma -1.400 5.1e-16
lung carcinoma -1.300 9.7e-11
non-small cell lung cancer -2.253 6.2e-27
osteosarcoma -1.933 4.3e-03
spina bifida -1.111 4.1e-02

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPF      1 - 70
VMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGH     71 - 140
SIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLS    141 - 210
LTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEE    211 - 280
PANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTT    281 - 350
DGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV                                  351 - 390
//

Text Mined References (22)

PMID Year Title