Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.27
PubTator Score 41.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.9e-16
diabetes mellitus 1663 1.0e-03
Disease Target Count Z-score Confidence
twin-to-twin transfusion syndrome 11 3.848 1.9
pre-eclampsia 67 3.845 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.300 1.0e-03
psoriasis -1.100 3.9e-16

Gene RIF (10)

PMID Text
25781974 These results thereby demonstrate that induced expression of Syncytin-2 is highly dependent on the interaction of bZIP-containing transcription factors to a CRE/AP-1 motif and that this element is important for the regulation of Syncytin-2 expression
23177091 MFSD2a, the Syncytin-2 receptor, is important for trophoblast fusion.
21771862 Analysis of non-spliced ERVFRDE1 mRNAs and env mRNAs detected efficient splicing of endogenously expressed RNAs in trophoblastic but not in non-placental cells.
21493955 results further highlighted the existence of a correlation between the extent of the decrease in the expression levels of both syncytins 1 and 2 fusogenic proteins and the degree of severity of preeclampsia symptoms
19616006 These results highlight the importance of Syncytin-2 in BeWo and primary human trophoblast cell fusion.
18650494 expression decreased in preeclamptic placentas; may function as a second fusogenic protein for placental cell fusion
18215254 Syncytin 2 expression illustrates the abnormal trophoblast differentiation observed in placenta of fetal T21-affected pregnancies.
18077339 findings show that in both humans and mice, one of the two syncytins (human syncytin-2 and mouse syncytin-B) is immunosuppressive and, rather unexpectedly, the other (human syncytin-1 and mouse syncytin-A) is not
16714059 immunolocalized only in the villous trophoblast of the chorionic villi, at the level of cytotrophoblastic cells
16140326 The crystal structure of a central fragment of syncytin 2 "fossil" ectodomain is reported, allowing a remarkable superposition with the structures of the corresponding domains of present-day infectious retroviruses

AA Sequence

MGLLLLVLILTPSLAAYRHPDFPLLEKAQQLLQSTGSPYSTNCWLCTSSSTETPGTAYPASPREWTSIEA      1 - 70
ELHISYRWDPNLKGLMRPANSLLSTVKQDFPDIRQKPPIFGPIFTNINLMGIAPICVMAKRKNGTNVGTL     71 - 140
PSTVCNVTFTVDSNQQTYQTYTHNQFRHQPRFPKPPNITFPQGTLLDKSSRFCQGRPSSCSTRNFWFRPA    141 - 210
DYNQCLQISNLSSTAEWVLLDQTRNSLFWENKTKGANQSQTPCVQVLAGMTIATSYLGISAVSEFFGTSL    211 - 280
TPLFHFHISTCLKTQGAFYICGQSIHQCLPSNWTGTCTIGYVTPDIFIAPGNLSLPIPIYGNSPLPRVRR    281 - 350
AIHFIPLLAGLGILAGTGTGIAGITKASLTYSQLSKEIANNIDTMAKALTTMQEQIDSLAAVVLQNRRGL    351 - 420
DMLTAAQGGICLALDEKCCFWVNQSGKVQDNIRQLLNQASSLRERATQGWLNWEGTWKWFSWVLPLTGPL    421 - 490
VSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF                          491 - 538
//

Text Mined References (25)

PMID Year Title
27486264 2016 The role of syncytins in human reproduction and reproductive organ cancers.
25781974 2015 A CRE/AP-1-like motif is essential for induced syncytin-2 expression and fusion in human trophoblast-like model.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
23177091 2013 MFSD2a, the Syncytin-2 receptor, is important for trophoblast fusion.
21771862 2011 Epigenetic regulation of transcription and splicing of syncytins, fusogenic glycoproteins of retroviral origin.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
21493955 2011 Reduced expression of both syncytin 1 and syncytin 2 correlates with severity of preeclampsia.
19616006 2009 Syncytin-2 plays an important role in the fusion of human trophoblast cells.
18988732 2008 A placenta-specific receptor for the fusogenic, endogenous retrovirus-derived, human syncytin-2.
18650494 2008 Functional characterization of the human placental fusogenic membrane protein syncytin 2.
18215254 2008 Human endogenous retrovirus-FRD envelope protein (syncytin 2) expression in normal and trisomy 21-affected placenta.
18077339 2007 Placental syncytins: Genetic disjunction between the fusogenic and immunosuppressive activity of retroviral envelope proteins.
16714059 Expression of the fusogenic HERV-FRD Env glycoprotein (syncytin 2) in human placenta is restricted to villous cytotrophoblastic cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16140326 2005 Crystal structure of a pivotal domain of human syncytin-2, a 40 million years old endogenous retrovirus fusogenic envelope gene captured by primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476554 2004 Identification of endogenous retroviral reading frames in the human genome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14694139 2004 Identification of an envelope protein from the FRD family of human endogenous retroviruses (HERV-FRD) conferring infectivity and functional conservation among simians.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.